Report for Sequence Feature Glyma03g07470
Feature Type: gene_model
Chromosome: Gm03
Start: 8058361
stop: 8059670
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g07470
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G40170 AT
Annotation by Michelle Graham. TAIR10: Stress induced protein | chr2:16779792-16780167 REVERSE LENGTH=92
SoyBase E_val: 1.00E-43 ISS
GO:0009640 GO-bp
Annotation by Michelle Graham. GO Biological Process: photomorphogenesis
SoyBase N/A ISS
GO:0009737 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus
SoyBase N/A ISS
GO:0009793 GO-bp
Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy
SoyBase N/A ISS
GO:0009845 GO-bp
Annotation by Michelle Graham. GO Biological Process: seed germination
SoyBase N/A ISS
GO:0009909 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of flower development
SoyBase N/A ISS
GO:0009933 GO-bp
Annotation by Michelle Graham. GO Biological Process: meristem structural organization
SoyBase N/A ISS
GO:0010162 GO-bp
Annotation by Michelle Graham. GO Biological Process: seed dormancy process
SoyBase N/A ISS
GO:0010182 GO-bp
Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway
SoyBase N/A ISS
GO:0010228 GO-bp
Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem
SoyBase N/A ISS
GO:0016114 GO-bp
Annotation by Michelle Graham. GO Biological Process: terpenoid biosynthetic process
SoyBase N/A ISS
GO:0016567 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein ubiquitination
SoyBase N/A ISS
GO:0019915 GO-bp
Annotation by Michelle Graham. GO Biological Process: lipid storage
SoyBase N/A ISS
GO:0048316 GO-bp
Annotation by Michelle Graham. GO Biological Process: seed development
SoyBase N/A ISS
GO:0048700 GO-bp
Annotation by Michelle Graham. GO Biological Process: acquisition of desiccation tolerance in seed
SoyBase N/A ISS
GO:0050826 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to freezing
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF00477 PFAM
Small hydrophilic plant seed protein
JGI ISS
UniRef100_I1JLC8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JLC8_SOYBN
SoyBase E_val: 4.00E-66 ISS
UniRef100_P93165 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Em protein n=1 Tax=Glycine max RepID=P93165_SOYBN
SoyBase E_val: 1.00E-65 ISS
Expression Patterns of Glyma03g07470
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma03g07470
Paralog Evidence Comments
Glyma01g29480 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma03g07470 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g056000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g07470
Coding sequences of Glyma03g07470
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g07470.1 sequence type=CDS gene model=Glyma03g07470 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCATCTCGTCAAAACAACAAGCAAGAGCTTGATGAAAGAGCAAGGCAAGGAGAGACTGTTGTCCCGGGTGGAACTGGTGGCAAGAGCCTGGAGGCTCAGCAACACCTTGCTGAAGGAAGGAGCAAGGGAGGGCAAACAAGGAAGGAACAGCTGGGTACAGAAGGGTACCAGGAAATGGGACGCAAAGGAGGGTTGAGCACTGTGGAGAAATCAGGAGAAGAACGTGCTCAAGAGGAAGGCATTGGCATCGATGAGTCCAAGTTCAGGACTGGTAATAACAAGAACCAGAATCAGAACGAAGACCAGGATAAGTGA
Predicted protein sequences of Glyma03g07470
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g07470.1 sequence type=predicted peptide gene model=Glyma03g07470 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MASRQNNKQELDERARQGETVVPGGTGGKSLEAQQHLAEGRSKGGQTRKEQLGTEGYQEMGRKGGLSTVEKSGEERAQEEGIGIDESKFRTGNNKNQNQNEDQDK*