SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g07411): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g07411): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g07411

Feature Type:gene_model
Chromosome:Gm03
Start:7953541
stop:7956223
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g07411
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G30060AT Annotation by Michelle Graham. TAIR10: Pleckstrin homology (PH) domain superfamily protein | chr2:12827035-12828551 FORWARD LENGTH=217 SoyBaseE_val: 2.00E-78ISS
GO:0000060GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus, translocation SoyBaseN/AISS
GO:0046907GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008536GO-mf Annotation by Michelle Graham. GO Molecular Function: Ran GTPase binding SoyBaseN/AISS
KOG0864 KOG Ran-binding protein RANBP1 and related RanBD domain proteins JGI ISS
PTHR23138Panther RAN BINDING PROTEIN JGI ISS
PTHR23138:SF10Panther RAN BINDING PROTEIN JGI ISS
PF00638PFAM RanBP1 domain JGI ISS
UniRef100_B9RSC5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ran binding protein, putative n=1 Tax=Ricinus communis RepID=B9RSC5_RICCO SoyBaseE_val: 1.00E-84ISS
UniRef100_UPI000233A033UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A033 related cluster n=1 Tax=unknown RepID=UPI000233A033 SoyBaseE_val: 4.00E-125ISS

Expression Patterns of Glyma03g07411
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g07411 not represented in the dataset
Glyma03g07411 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g07411
ParalogEvidenceComments
Glyma01g29410 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g07411 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g055400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g07411
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g07411
>Glyma03g07411.1   sequence type=CDS   gene model=Glyma03g07411   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CAGCATCAATGGCCACCACCGAGCCACCACAATGACGACGATGACCATGTGCCAGCGGAGGACGAGGACACGGGAGCGCAGGTCGCTCCGATCGTGAAGCTCGAAGAGGTCGCCGTCTCCACTGGTGAAGAGGAAGAGGATCCCATCCTTGATCTGAAAGCGAACCTGTATCGGTTCGATAACGAAGGGAATGAGTGGAAGGAGCGTGGTGGTGGAAACGTTAAGCTGCTGAAACATAAGGTCAGCGGGAAGGTGAGGCTCGTCATGCGCCAATCCAAGACGCTCTCAAGATCTGCGCCAATCATCTTGGAGCATTCTGGGAATGAGAAATCGTGTGTGTGGCATGCTTCTGATTTTGCAGATGGAGAATTGAAGGATGAGCTGTTCTGTATTAGGTTTCCCTCTGTTGAGAACTGCAAGGCCTTCATGAAAACTATGCAAGAAGTGGCTGAATCACAAGGAGAGGAGGAGGAAAACAAAGATGCTTCAGCTGCTGCCGGTCTCCTCAAGAAACTAACTGTTGGCGAGGATAAATTGGAGGACAAAGAGCCGCCGGAAAAGGCCACGGATACCAATGTGAAAGGTGAGCAGGATGTATAG
Predicted protein sequences of Glyma03g07411
>Glyma03g07411.1   sequence type=predicted peptide   gene model=Glyma03g07411   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
QHQWPPPSHHNDDDDHVPAEDEDTGAQVAPIVKLEEVAVSTGEEEEDPILDLKANLYRFDNEGNEWKERGGGNVKLLKHKVSGKVRLVMRQSKTLSRSAPIILEHSGNEKSCVWHASDFADGELKDELFCIRFPSVENCKAFMKTMQEVAESQGEEEENKDASAAAGLLKKLTVGEDKLEDKEPPEKATDTNVKGEQDV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo