SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g06950): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g06950): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g06950

Feature Type:gene_model
Chromosome:Gm03
Start:7217997
stop:7224400
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G72900AT Annotation by Michelle Graham. TAIR10: Toll-Interleukin-Resistance (TIR) domain-containing protein | chr1:27432216-27433532 FORWARD LENGTH=363 SoyBaseE_val: 1.00E-38ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0009610GO-bp Annotation by Michelle Graham. GO Biological Process: response to symbiotic fungus SoyBaseN/AISS
GO:0009625GO-bp Annotation by Michelle Graham. GO Biological Process: response to insect SoyBaseN/AISS
GO:0009693GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0051707GO-bp Annotation by Michelle Graham. GO Biological Process: response to other organism SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0043531GO-mf Annotation by Michelle Graham. GO Molecular Function: ADP binding SoyBaseN/AISS
PTHR23155Panther LEUCINE-RICH REPEAT-CONTAINING PROTEIN JGI ISS
PTHR23155:SF300Panther JGI ISS
PF01582PFAM TIR domain JGI ISS
UniRef100_G7JLX5UniRef Annotation by Michelle Graham. Most informative UniRef hit: TIR-NBS-LRR RCT1-like resistance protein n=1 Tax=Medicago truncatula RepID=G7JLX5_MEDTR SoyBaseE_val: 3.00E-58ISS
UniRef100_I1JLA3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JLA3_SOYBN SoyBaseE_val: 2.00E-115ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g06950 not represented in the dataset

Glyma03g06950 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g053300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g06950.2   sequence type=CDS   gene model=Glyma03g06950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTTCTTCCTCTAGTTATGACTACGATCTCCATGATGATGACGAGATGGACTTTCTGCGTGATCGGTACAAGGAGGACAACATAAACTATGATGTGTTTTTGAGTTTCAGAGGGGAAGACACGCGTGCTTCTTTCACTTCACATCTCTATACGGCTCTTCACAACTTGGGAATCTTTGTTTTCAAGGATGATGAGACACTTCCAAGGGGAAATAAAATTTCACCCTCGCTGCGGTTAGCAATTGAAGAGTCTAGACTTTCTGTTGTTATTTTCTCTAGAAACTATGCAGAGTCGCGGTGGTGTTTGAAAGAGTTGGAGAAAATAATGGAGTGTCACAGAACAACAGGGCAAGTGGTAGTGCCAGTGTTCTATGATGTAGATCCCTCTGAAGTACGTCATCAAACAGGCCACTTTGGAAAAGCATTTCGAAACCTTGAGAACAGACTTTTAAAAGTGGTAGAGGAAAAGGAAGAGGAAAAGCTACAACGATGGTGGAAGACGCTTGCTGAGGCCGCTGGCATCTCAGGGCTTTCTGTAATAAAAACACTTCCAGCTTTCTCGTATTTTTACTGA

>Glyma03g06950.2   sequence type=predicted peptide   gene model=Glyma03g06950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSSSSYDYDLHDDDEMDFLRDRYKEDNINYDVFLSFRGEDTRASFTSHLYTALHNLGIFVFKDDETLPRGNKISPSLRLAIEESRLSVVIFSRNYAESRWCLKELEKIMECHRTTGQVVVPVFYDVDPSEVRHQTGHFGKAFRNLENRLLKVVEEKEEEKLQRWWKTLAEAAGISGLSVIKTLPAFSYFY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo