Glyma03g06950 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g06950): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g06950): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g06950

Feature Type:	gene_model
Chromosome:	Gm03
Start:	7217997
stop:	7224400
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g06950

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G72900	AT	Annotation by Michelle Graham. TAIR10: Toll-Interleukin-Resistance (TIR) domain-containing protein \| chr1:27432216-27433532 FORWARD LENGTH=363	SoyBase	E_val: 1.00E-38	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0009610	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to symbiotic fungus	SoyBase	N/A	ISS
GO:0009625	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to insect	SoyBase	N/A	ISS
GO:0009693	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process	SoyBase	N/A	ISS
GO:0009862	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009863	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0031348	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response	SoyBase	N/A	ISS
GO:0043069	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death	SoyBase	N/A	ISS
GO:0051707	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to other organism	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0043531	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ADP binding	SoyBase	N/A	ISS
PTHR23155	Panther	LEUCINE-RICH REPEAT-CONTAINING PROTEIN	JGI		ISS
PTHR23155:SF300	Panther		JGI		ISS
PF01582	PFAM	TIR domain	JGI		ISS
UniRef100_G7JLX5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: TIR-NBS-LRR RCT1-like resistance protein n=1 Tax=Medicago truncatula RepID=G7JLX5_MEDTR	SoyBase	E_val: 3.00E-58	ISS
UniRef100_I1JLA3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JLA3_SOYBN	SoyBase	E_val: 2.00E-115	ISS

Expression Patterns of Glyma03g06950

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g06950 not represented in the dataset	Glyma03g06950 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g06950 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g053300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g06950

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g06950

Limit To All Plant Sequences

>Glyma03g06950.2   sequence type=CDS   gene model=Glyma03g06950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTTCTTCCTCTAGTTATGACTACGATCTCCATGATGATGACGAGATGGACTTTCTGCGTGATCGGTACAAGGAGGACAACATAAACTATGATGTGTTTTTGAGTTTCAGAGGGGAAGACACGCGTGCTTCTTTCACTTCACATCTCTATACGGCTCTTCACAACTTGGGAATCTTTGTTTTCAAGGATGATGAGACACTTCCAAGGGGAAATAAAATTTCACCCTCGCTGCGGTTAGCAATTGAAGAGTCTAGACTTTCTGTTGTTATTTTCTCTAGAAACTATGCAGAGTCGCGGTGGTGTTTGAAAGAGTTGGAGAAAATAATGGAGTGTCACAGAACAACAGGGCAAGTGGTAGTGCCAGTGTTCTATGATGTAGATCCCTCTGAAGTACGTCATCAAACAGGCCACTTTGGAAAAGCATTTCGAAACCTTGAGAACAGACTTTTAAAAGTGGTAGAGGAAAAGGAAGAGGAAAAGCTACAACGATGGTGGAAGACGCTTGCTGAGGCCGCTGGCATCTCAGGGCTTTCTGTAATAAAAACACTTCCAGCTTTCTCGTATTTTTACTGA

Predicted protein sequences of Glyma03g06950

Limit To All Plant Sequences

>Glyma03g06950.2   sequence type=predicted peptide   gene model=Glyma03g06950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSSSSYDYDLHDDDEMDFLRDRYKEDNINYDVFLSFRGEDTRASFTSHLYTALHNLGIFVFKDDETLPRGNKISPSLRLAIEESRLSVVIFSRNYAESRWCLKELEKIMECHRTTGQVVVPVFYDVDPSEVRHQTGHFGKAFRNLENRLLKVVEEKEEEKLQRWWKTLAEAAGISGLSVIKTLPAFSYFY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain