SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g06878): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g06878): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g06878

Feature Type:gene_model
Chromosome:Gm03
Start:7188757
stop:7190509
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G40170AT Annotation by Michelle Graham. TAIR10: receptor like protein 54 | chr5:16065179-16067557 REVERSE LENGTH=792 SoyBaseE_val: 1.00E-35ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF473Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_G7JR92UniRef Annotation by Michelle Graham. Most informative UniRef hit: Receptor-like protein kinase n=1 Tax=Medicago truncatula RepID=G7JR92_MEDTR SoyBaseE_val: 8.00E-71ISS
UniRef100_I1JLA2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JLA2_SOYBN SoyBaseE_val: 3.00E-156ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g06878 not represented in the dataset

Glyma03g06878 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g053000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g06878.1   sequence type=CDS   gene model=Glyma03g06878   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGAAATTATCTGAATTGAATCTTTCTAAATGTGGATTTAGCAGGACAATTTCCAATTCACCGTCAAACCTAACAAAACTTGTCCAAATTGACCTGAAGAGCCTTGATATAAGTAACAATAATCCATCTGGGAGGGTTCCTAGATTCCTTTTTACTAGCCGATCAATTCAGCTTTTCCACAATCATTTTAGTCAACTAGACAAAATCAGAAATGTGTCTAGATTGTACAGCCTCGATTTAAGTAGCAATGATCTATTCGGGCCTTTTTCAACATCTATCCTCCAACTCAATACACTTTTTGTCCTCCATTTTTCTTCAAACCAGTTTAATGGGTCAGTACAGCTGAATAAGCTTCTTGAGGTTAAAAGTTTAACTGAGCTTGACCTTTCATGCATCAACTTAAAATTGATCATCCCCAATTCCATCTACATTGCTTCATCTCTCCAAGTGTTTGATCTTTCCTTGAATAACATTTATGGAACAATAATCTCATGTTTAATGAGGATGACTTCGTGTAGTTTATGGATTTTAAATCTTCATGGAAATCTATTAGATGGGCCAATTCCAAATTCTCTTTCGTGTTGCTTGAAGTTAAAGGTATTGGACCTTGGATTAAATCAAATTATTGGTGGCTTTCCATGCTTTTTGAAGAAAATATCCACACTTGGTATCCTGGTTTTGTGGAAAAACAAATTTCAAGGCTCCCTAAGATGTTCGAAAACCAATAAGACTTGGGAAATACTTCAAATTGTGGACATCGCTTTTAACAATTTTAGCGGTAAACTGCCAGGAAAATATTTCACAACCTGGGAAAGATATATAATGCATGGTGAACAAGAAACTGAATCAAAGTTTATAGAGAAGGGGTTTCATGCACAAATGGGTAATTTGGCTAAAATTTTTACAATCTTTACATCTATTGATTTCTCATCCAACCATTTTGAAGGACCTGTAACAAAGGAGCATATGGATTTCAAAGAACTCTGTATCTTTTTGTCAAAAACTGCTTCGTCTAGTGAAATCCCATTATCCATAGGTAACTTGAGACGACTGGAGTCTTTGTGCCTTTCACAAAACTAG

>Glyma03g06878.1   sequence type=predicted peptide   gene model=Glyma03g06878   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRKLSELNLSKCGFSRTISNSPSNLTKLVQIDLKSLDISNNNPSGRVPRFLFTSRSIQLFHNHFSQLDKIRNVSRLYSLDLSSNDLFGPFSTSILQLNTLFVLHFSSNQFNGSVQLNKLLEVKSLTELDLSCINLKLIIPNSIYIASSLQVFDLSLNNIYGTIISCLMRMTSCSLWILNLHGNLLDGPIPNSLSCCLKLKVLDLGLNQIIGGFPCFLKKISTLGILVLWKNKFQGSLRCSKTNKTWEILQIVDIAFNNFSGKLPGKYFTTWERYIMHGEQETESKFIEKGFHAQMGNLAKIFTIFTSIDFSSNHFEGPVTKEHMDFKELCIFLSKTASSSEIPLSIGNLRRLESLCLSQN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo