SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g06792): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g06792): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g06792

Feature Type:gene_model
Chromosome:Gm03
Start:7063582
stop:7064436
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G01310AT Annotation by Michelle Graham. TAIR10: APRATAXIN-like | chr5:125304-128960 FORWARD LENGTH=912 SoyBaseE_val: 2.00E-32ISS
GO:0006259GO-bp Annotation by Michelle Graham. GO Biological Process: DNA metabolic process SoyBaseN/AISS
GO:0006310GO-bp Annotation by Michelle Graham. GO Biological Process: DNA recombination SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006396GO-bp Annotation by Michelle Graham. GO Biological Process: RNA processing SoyBaseN/AISS
GO:0006790GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur compound metabolic process SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0009150GO-bp Annotation by Michelle Graham. GO Biological Process: purine ribonucleotide metabolic process SoyBaseN/AISS
GO:0010332GO-bp Annotation by Michelle Graham. GO Biological Process: response to gamma radiation SoyBaseN/AISS
GO:0010413GO-bp Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process SoyBaseN/AISS
GO:0022402GO-bp Annotation by Michelle Graham. GO Biological Process: cell cycle process SoyBaseN/AISS
GO:0032204GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of telomere maintenance SoyBaseN/AISS
GO:0033044GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization SoyBaseN/AISS
GO:0042138GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation SoyBaseN/AISS
GO:0043247GO-bp Annotation by Michelle Graham. GO Biological Process: telomere maintenance in response to DNA damage SoyBaseN/AISS
GO:0045132GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation SoyBaseN/AISS
GO:0045492GO-bp Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0047627GO-mf Annotation by Michelle Graham. GO Molecular Function: adenylylsulfatase activity SoyBaseN/AISS
PTHR12565Panther STEROL REGULATORY ELEMENT-BINDING PROTEIN JGI ISS
PTHR12565:SF7Panther CENTROMERE-BINDING PROTEIN 1, CBP-1 JGI ISS
PF00010PFAM Helix-loop-helix DNA-binding domain JGI ISS
UniRef100_G7KSC0UniRef Annotation by Michelle Graham. Most informative UniRef hit: LAX n=1 Tax=Medicago truncatula RepID=G7KSC0_MEDTR SoyBaseE_val: 8.00E-38ISS
UniRef100_I1JL99UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JL99_SOYBN SoyBaseE_val: 1.00E-79ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g06792 not represented in the dataset

Glyma03g06792 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma01g30660 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g052300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g06792.1   sequence type=CDS   gene model=Glyma03g06792   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCATCATCACACTCCTTCCACTAACCAAACCTCATCATCTCAATTCTCTTCTTCAAAACCAAACCAAATTTCAAACAAGGAGAAAAAGGGTGTCAAAAAATGCAAAGGGGTAATGAGGCTTTCCACCGACCCACAAAGCGTGGCAGCAAGAGAACGAAGGCACAGAATCAGTGACAGGTTCAAGATCCTGCAGAGCATGGTCCCTGGTGGGAGCAAGATGGATACAGTATCCATGCTTGAAGAAGCCATTCAGTATGTGAAGTTCCTCAAGACCCAGATTTGGCTCCACCAAACCATGATCAACTTCATGGACAATGATAATTACAATATTAATGATAATAATGAGTCTTCTTCTTTACTGTACCCTAATAACGATTGTTGCTACTTCCCTTCTGAACATTTTGTTTCACCTCAGCAAAATGCAACGTTTGATTATAGCAACATGCAGGATTTGCAGCATCTGCAGCCACTGGCAGCACAATGCGGCTTCCAAGGTGAAGACTCGAACTATTTTGATGCCTCTTTGAAATATTGGCCAGCTTGA

>Glyma03g06792.1   sequence type=predicted peptide   gene model=Glyma03g06792   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDHHHTPSTNQTSSSQFSSSKPNQISNKEKKGVKKCKGVMRLSTDPQSVAARERRHRISDRFKILQSMVPGGSKMDTVSMLEEAIQYVKFLKTQIWLHQTMINFMDNDNYNINDNNESSSLLYPNNDCCYFPSEHFVSPQQNATFDYSNMQDLQHLQPLAAQCGFQGEDSNYFDASLKYWPA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo