SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g04935): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g04935): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g04935

Feature Type:gene_model
Chromosome:Gm03
Start:5130064
stop:5130526
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g04935
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G27020AT Annotation by Michelle Graham. TAIR10: YELLOW STRIPE like 6 | chr3:9961623-9964461 REVERSE LENGTH=676 SoyBaseE_val: 1.00E-37ISS
GO:0006857GO-bp Annotation by Michelle Graham. GO Biological Process: oligopeptide transport SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
PF03169PFAM OPT oligopeptide transporter protein JGI ISS
UniRef100_G7L290UniRef Annotation by Michelle Graham. Most informative UniRef hit: Yellow stripe-like protein 1.1 n=1 Tax=Medicago truncatula RepID=G7L290_MEDTR SoyBaseE_val: 4.00E-39ISS
UniRef100_UPI000233ED7DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233ED7D related cluster n=1 Tax=unknown RepID=UPI000233ED7D SoyBaseE_val: 9.00E-41ISS

Expression Patterns of Glyma03g04935
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g04935 not represented in the dataset
Glyma03g04935 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g04935 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g040200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g04935
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g04935
>Glyma03g04935.1   sequence type=CDS   gene model=Glyma03g04935   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTTGGAATATAAGCTTACATATCCCAGTGGGAGAGCCACAACAATGCTAATCAACAGTTTCCATACAAAAACTAGAGCAGAACTTGCTGCGAACCAAGTTCGGCAGCTTGGGAAGTATCTAAGCATAAGTTTCTGCTGGAGTTGCTTTAAGTGGTTCTTCAGTGGTATTGGGGATTTATGTGGGTTTGACAAGTTCCCTAGCTTTGGTTTGACACTATTTAAGAACACGTAA
Predicted protein sequences of Glyma03g04935
>Glyma03g04935.1   sequence type=predicted peptide   gene model=Glyma03g04935   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALEYKLTYPSGRATTMLINSFHTKTRAELAANQVRQLGKYLSISFCWSCFKWFFSGIGDLCGFDKFPSFGLTLFKNT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo