|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G33820 | AT | Annotation by Michelle Graham. TAIR10: Mitochondrial substrate carrier family protein | chr2:14306293-14308293 REVERSE LENGTH=311 | SoyBase | E_val: 4.00E-52 | ISS |
| GO:0006810 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transport | SoyBase | N/A | ISS |
| GO:0006839 | GO-bp | Annotation by Michelle Graham. GO Biological Process: mitochondrial transport | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0005743 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane | SoyBase | N/A | ISS |
| GO:0000064 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: L-ornithine transmembrane transporter activity | SoyBase | N/A | ISS |
| GO:0005215 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transporter activity | SoyBase | N/A | ISS |
| GO:0005290 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: L-histidine transmembrane transporter activity | SoyBase | N/A | ISS |
| GO:0015181 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: arginine transmembrane transporter activity | SoyBase | N/A | ISS |
| GO:0015189 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: L-lysine transmembrane transporter activity | SoyBase | N/A | ISS |
| PTHR24089 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR24089:SF54 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| PF00153 | PFAM | Mitochondrial carrier protein | JGI | ISS | |
| UniRef100_B9RBB5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial carnitine/acylcarnitine carrier protein, putative n=1 Tax=Ricinus communis RepID=B9RBB5_RICCO | SoyBase | E_val: 4.00E-61 | ISS |
| UniRef100_I1KLM9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KLM9_SOYBN | SoyBase | E_val: 2.00E-80 | ISS |
|
Glyma03g04680 not represented in the dataset |
Glyma03g04680 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.03g038000 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma03g04680.1 sequence type=CDS gene model=Glyma03g04680 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high GAATCTATAGGGAATGTTGTCCTTTTCAGTGTATACGAATATGTGTGTTATTACATGCATTCAAATATCAAAGTTGCTTCATCCAATTACACCAACCTAGTTGATATTGGAATTGGGATCGTTAGTGGTGGCCTTGGTGGTGTGGCTTTTTGGTTGACAGTTTTGCCTCTTGATGTGGCAAAGACTTTAATTCAGACAAACCCTGATAAAAATTGTCCAAGAAATCCTTTTCGGGTCTTGAGTTCAATCTATCAAAGGGCTGGATTCAACGGATGCTATACAGGTTTGGGTCCTACTGTAAGTCGAGCATTTCCTGCTAATGCTGCAATAATAGTCGCATGGGAGCTAGCATTGAAAATGCTAGGCATTAAGCATGACTGA
>Glyma03g04680.1 sequence type=predicted peptide gene model=Glyma03g04680 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ESIGNVVLFSVYEYVCYYMHSNIKVASSNYTNLVDIGIGIVSGGLGGVAFWLTVLPLDVAKTLIQTNPDKNCPRNPFRVLSSIYQRAGFNGCYTGLGPTVSRAFPANAAIIVAWELALKMLGIKHD*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||