|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G74560 | AT | Annotation by Michelle Graham. TAIR10: NAP1-related protein 1 | chr1:28017815-28019900 REVERSE LENGTH=256 | SoyBase | E_val: 9.00E-14 | ISS |
GO:0006094 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gluconeogenesis | SoyBase | N/A | ISS |
GO:0006096 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycolysis | SoyBase | N/A | ISS |
GO:0006333 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin assembly or disassembly | SoyBase | N/A | ISS |
GO:0006334 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nucleosome assembly | SoyBase | N/A | ISS |
GO:0008283 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell proliferation | SoyBase | N/A | ISS |
GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
GO:0010311 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lateral root formation | SoyBase | N/A | ISS |
GO:0030154 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell differentiation | SoyBase | N/A | ISS |
GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
GO:0003682 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: chromatin binding | SoyBase | N/A | ISS |
GO:0042393 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: histone binding | SoyBase | N/A | ISS |
PTHR11875 | Panther | NUCLEOSOME ASSEMBLY PROTEIN | JGI | ISS | |
PTHR11875:SF47 | Panther | JGI | ISS | ||
PF00956 | PFAM | Nucleosome assembly protein (NAP) | JGI | ISS | |
UniRef100_C6TL10 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TL10_SOYBN | SoyBase | E_val: 8.00E-18 | ISS |
UniRef100_G7JQZ6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Protein SET n=1 Tax=Medicago truncatula RepID=G7JQZ6_MEDTR | SoyBase | E_val: 7.00E-12 | ISS |
Glyma03g04055 not represented in the dataset |
Glyma03g04055 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma03g04055.1 sequence type=CDS gene model=Glyma03g04055 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high TTCTTTAGTTGGTTTAGTGACCGTGAGCAAAAAGATGATGTGGATGAAATTCATGACGAGGTTGCAGAATTAATCAAGGATGATTTATGGCCAAATCCACTCACTTATTTCAACAAT
>Glyma03g04055.1 sequence type=predicted peptide gene model=Glyma03g04055 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high FFSWFSDREQKDDVDEIHDEVAELIKDDLWPNPLTYFNN
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||