SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g04055

Feature Type:gene_model
Chromosome:Gm03
Start:4030351
stop:4030585
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g04055
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G74560AT Annotation by Michelle Graham. TAIR10: NAP1-related protein 1 | chr1:28017815-28019900 REVERSE LENGTH=256 SoyBaseE_val: 9.00E-14ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006333GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin assembly or disassembly SoyBaseN/AISS
GO:0006334GO-bp Annotation by Michelle Graham. GO Biological Process: nucleosome assembly SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0010311GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root formation SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003682GO-mf Annotation by Michelle Graham. GO Molecular Function: chromatin binding SoyBaseN/AISS
GO:0042393GO-mf Annotation by Michelle Graham. GO Molecular Function: histone binding SoyBaseN/AISS
PTHR11875Panther NUCLEOSOME ASSEMBLY PROTEIN JGI ISS
PTHR11875:SF47Panther JGI ISS
PF00956PFAM Nucleosome assembly protein (NAP) JGI ISS
UniRef100_C6TL10UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TL10_SOYBN SoyBaseE_val: 8.00E-18ISS
UniRef100_G7JQZ6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein SET n=1 Tax=Medicago truncatula RepID=G7JQZ6_MEDTR SoyBaseE_val: 7.00E-12ISS

Expression Patterns of Glyma03g04055
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g04055 not represented in the dataset
Glyma03g04055 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g04055 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma03g04055
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g04055
>Glyma03g04055.1   sequence type=CDS   gene model=Glyma03g04055   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTCTTTAGTTGGTTTAGTGACCGTGAGCAAAAAGATGATGTGGATGAAATTCATGACGAGGTTGCAGAATTAATCAAGGATGATTTATGGCCAAATCCACTCACTTATTTCAACAAT
Predicted protein sequences of Glyma03g04055
>Glyma03g04055.1   sequence type=predicted peptide   gene model=Glyma03g04055   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FFSWFSDREQKDDVDEIHDEVAELIKDDLWPNPLTYFNN






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo