SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g03910

Feature Type:gene_model
Chromosome:Gm03
Start:3813045
stop:3822988
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g03910
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G18950AT Annotation by Michelle Graham. TAIR10: homogentisate phytyltransferase 1 | chr2:8207491-8210047 FORWARD LENGTH=393 SoyBaseE_val: 3.00E-118ISS
GO:0000096GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process SoyBaseN/AISS
GO:0006546GO-bp Annotation by Michelle Graham. GO Biological Process: glycine catabolic process SoyBaseN/AISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0006733GO-bp Annotation by Michelle Graham. GO Biological Process: oxidoreduction coenzyme metabolic process SoyBaseN/AISS
GO:0006766GO-bp Annotation by Michelle Graham. GO Biological Process: vitamin metabolic process SoyBaseN/AISS
GO:0008652GO-bp Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process SoyBaseN/AISS
GO:0009072GO-bp Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family metabolic process SoyBaseN/AISS
GO:0009106GO-bp Annotation by Michelle Graham. GO Biological Process: lipoate metabolic process SoyBaseN/AISS
GO:0009108GO-bp Annotation by Michelle Graham. GO Biological Process: coenzyme biosynthetic process SoyBaseN/AISS
GO:0009117GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009915GO-bp Annotation by Michelle Graham. GO Biological Process: phloem sucrose loading SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010189GO-bp Annotation by Michelle Graham. GO Biological Process: vitamin E biosynthetic process SoyBaseN/AISS
GO:0015994GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll metabolic process SoyBaseN/AISS
GO:0019216GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of lipid metabolic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019748GO-bp Annotation by Michelle Graham. GO Biological Process: secondary metabolic process SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0031408GO-bp Annotation by Michelle Graham. GO Biological Process: oxylipin biosynthetic process SoyBaseN/AISS
GO:0042362GO-bp Annotation by Michelle Graham. GO Biological Process: fat-soluble vitamin biosynthetic process SoyBaseN/AISS
GO:0044272GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur compound biosynthetic process SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0004659GO-mf Annotation by Michelle Graham. GO Molecular Function: prenyltransferase activity SoyBaseN/AISS
GO:0010176GO-mf Annotation by Michelle Graham. GO Molecular Function: homogentisate phytyltransferase activity SoyBaseN/AISS
PTHR11048Panther PRENYLTRANSFERASES JGI ISS
PTHR11048:SF1Panther 4-HYDROXYBENZOATE OCTAPRENYLTRANSFERASE JGI ISS
PF01040PFAM UbiA prenyltransferase family JGI ISS
UniRef100_B9A1Q4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glycinol 4-dimethylallyltransferase n=1 Tax=Glycine max RepID=G4DT_SOYBN SoyBaseE_val: 4.00E-176ISS
UniRef100_UPI0002339933UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339933 related cluster n=1 Tax=unknown RepID=UPI0002339933 SoyBaseE_val: 0ISS

Expression Patterns of Glyma03g03910
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g03910
ParalogEvidenceComments
Glyma01g33070 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g03910 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g033100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g03910
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g03910
>Glyma03g03910.2   sequence type=CDS   gene model=Glyma03g03910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGGAATCTCCGGCGGAGTAAACATTCCACCAAGAATTTTTACTATGCAAGTTTTGGTGAATTAAAAGCTTCACAAGAGAAAAGAGCAACTCAAACTGAATATAATCATTTGAGGTTGCAGCAATCAAGTTTGAACCATTATTACAAATGCATTGAAGGAGGTTCTACATATCAACAATATACCAGAAAATATGTTTTGAAAGCAGTCCCTAGACCATCTTTTGATTTTGAACCTCATGCTTCTGATCCCAAAAACATTTTAGACTCTGTCAAAAAACTCTTGGTTGCTTTCTATTGGTTTTGCTATCCTTACTCAATGATTGGCCAAATGTTAAGCATAATTTCTACGTCTCTTCTTGCAGTGGAGAAACTATCATATATATCTCCACTATTTTTTATTGGTGTGTTACAGGCTATGGTACCTCAGTTGTTTATGAGTATTTATATGAATGGTGTGAATCAATTGTTTGACGTTGAAATAGACAAGATTAACAAACCACATCTTCCATTGGCATCTGGTCAATTATCCTTTAGAACTGGCGCCATTATTGTTGCATCATGTTTAACTTTGAGTCTTTGGATTAGCTGGATTGTAGGTTCTTGGCCATTGATTTGGAATATTGGATTGTGCTCTTTGATATGGACAGCTTATTCAATCAATGCACCTTTGTTGAGATGGAAGAGACATCCATTGCTAGCGGCAATGTGTATTTTTGCAACTATGGCACTTATATTTCCAATTACAATATTCCTTCATATACAGACCTTTGTGTTGAAGAGGCCCACAGTCTTTTCCAGATCATTGATTTTTGAGGTTGCATTCATGAGTTTATACTCTATAGGTATAGCCTTGTACAAGGATGTACCTGACATTGAAGGAGATAAAGCATTTGGTATTCATTCTATTTCGGCACGTTTAGGTCAAAAATGGGTATTTTGGCTTTGTGTTTTCCTTTTTGAAATGGCTTTTGGAGTTGGCCTTCTGGCTGGAGCATCATCTTCTTACCTTTGGATTAAAATTGTCACGGGTTTGGGATATGCTGTTCTTGCTTCAGTACTTTGGCACCAGGCCAAAATTGTAGATTTGAAAAGCAAAACTTCAATGAGATCATTCTATATGTTGATTTGGAAGTTGTTGTACGTGGCGTACTTTCTCATGCCTTTAATTAGCCAAGGATGTCATTGA
Predicted protein sequences of Glyma03g03910
>Glyma03g03910.2   sequence type=predicted peptide   gene model=Glyma03g03910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GNLRRSKHSTKNFYYASFGELKASQEKRATQTEYNHLRLQQSSLNHYYKCIEGGSTYQQYTRKYVLKAVPRPSFDFEPHASDPKNILDSVKKLLVAFYWFCYPYSMIGQMLSIISTSLLAVEKLSYISPLFFIGVLQAMVPQLFMSIYMNGVNQLFDVEIDKINKPHLPLASGQLSFRTGAIIVASCLTLSLWISWIVGSWPLIWNIGLCSLIWTAYSINAPLLRWKRHPLLAAMCIFATMALIFPITIFLHIQTFVLKRPTVFSRSLIFEVAFMSLYSIGIALYKDVPDIEGDKAFGIHSISARLGQKWVFWLCVFLFEMAFGVGLLAGASSSYLWIKIVTGLGYAVLASVLWHQAKIVDLKSKTSMRSFYMLIWKLLYVAYFLMPLISQGCH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo