Glyma03g03815 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g03815

Feature Type:	gene_model
Chromosome:	Gm03
Start:	3670319
stop:	3673044
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g03815

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G11530	AT	Annotation by Michelle Graham. TAIR10: cysteine-rich RLK (RECEPTOR-like protein kinase) 34 \| chr4:6987093-6989599 FORWARD LENGTH=669	SoyBase	E_val: 6.00E-29	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0004713	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
KOG1187	KOG	Serine/threonine protein kinase	JGI		ISS
PTHR24420	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24420:SF683	Panther		JGI		ISS
PF00069	PFAM	Protein kinase domain	JGI		ISS
UniRef100_C5Z6B5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein Sb10g006630 n=1 Tax=Sorghum bicolor RepID=C5Z6B5_SORBI	SoyBase	E_val: 5.00E-33	ISS
UniRef100_Q84QD9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Avr9/Cf-9 induced kinase 1 n=1 Tax=Nicotiana tabacum RepID=Q84QD9_TOBAC	SoyBase	E_val: 2.00E-27	ISS

Expression Patterns of Glyma03g03815

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g03815 not represented in the dataset	Glyma03g03815 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g03815

Paralog	Evidence	Comments
Glyma01g33181	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g03815 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g032300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g03815

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g03815

Limit To All Plant Sequences

>Glyma03g03815.1   sequence type=CDS   gene model=Glyma03g03815   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACCCAACAACAAACCTTGTTGAGTTTTCATCTCAGAATTTGGAAGCATGTACCAACAATTTCAGTCAGAGCAATCTCATTGGCTTGACAAAGTTTGGTAGATTGTATAGAGGCATCCTTGAAGGTCAACATGTAGTAGTGAAGATATGGGATGGTGAAAGAATGGAACAGTTAAGTTCCAAATATGATGATGAGAATTTGATTATCAAAGAGGAAGTAAAATTTTGGACTAATCCAACATTAAGAGGTTACCCCAATTTGGTGAAGTTGATTGGTTATACTTGGGAGAGAGATGCAAAGGGACTTGTTTATGATCTCAATCCACTTGATACTTTGGATAACGTAATAATGAAAGATAACCTGAATTGGCTTCAGAGAATAAATGTAATTCATGAACTTGCAAAGCTCCTGAAATTCATTCATGACCAGGAAAAGCAAAATATGGTGTTGAATATCAGTGCATCTCATATTCTTCTCGACAAGGATTACAAGCCAAATTTTATTGATTTGGTGTTGCTTAGTGAAGTGACAATGCTAAGGGAACAACTAACAATGTCAACTAGCTACATCAATCCTTATTTTTCTCTAAGGGGTGGTGAATGGGATAGAAGCTGTGAAGTGTTCTCATTTGGCATTGTTTTGCTTGAACTAATAACCAAAAGAGTTTCAGTCATTGGGAAGAGAGAACATGCAAGCATAAACTTGGACGGTGTGGTTCATATTTGGGCCAAGAAAGAATACAAGCCAAATTGTTCTCTTGTCCATGAAACTTTGCAGGAAGATTGGTGTTACTGTGCTGAAGATGGTGTTTCAATAACTTTATTGGCATTGCAATGCATAGAATTTTTTCCAGCAAACCGTCCAACAATGAGGGATGTCTTGCACAGGCTAGATAATCTTTTGGTGTTACAACGTATGGCTGATGCTAGAGCAACCAAAAGGGAAAAGCAACTCATTTCATCCTGA

Predicted protein sequences of Glyma03g03815

Limit To All Plant Sequences

>Glyma03g03815.1   sequence type=predicted peptide   gene model=Glyma03g03815   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDPTTNLVEFSSQNLEACTNNFSQSNLIGLTKFGRLYRGILEGQHVVVKIWDGERMEQLSSKYDDENLIIKEEVKFWTNPTLRGYPNLVKLIGYTWERDAKGLVYDLNPLDTLDNVIMKDNLNWLQRINVIHELAKLLKFIHDQEKQNMVLNISASHILLDKDYKPNFIDLVLLSEVTMLREQLTMSTSYINPYFSLRGGEWDRSCEVFSFGIVLLELITKRVSVIGKREHASINLDGVVHIWAKKEYKPNCSLVHETLQEDWCYCAEDGVSITLLALQCIEFFPANRPTMRDVLHRLDNLLVLQRMADARATKREKQLISS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain