SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g03781

Feature Type:gene_model
Chromosome:Gm03
Start:3614046
stop:3619183
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g03781
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G28730AT Annotation by Michelle Graham. TAIR10: high mobility group | chr3:10784954-10788498 FORWARD LENGTH=646 SoyBaseE_val: 0ISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0006306GO-bp Annotation by Michelle Graham. GO Biological Process: DNA methylation SoyBaseN/AISS
GO:0006342GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing SoyBaseN/AISS
GO:0006346GO-bp Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing SoyBaseN/AISS
GO:0006366GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from RNA polymerase II promoter SoyBaseN/AISS
GO:0007267GO-bp Annotation by Michelle Graham. GO Biological Process: cell-cell signaling SoyBaseN/AISS
GO:0009616GO-bp Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing SoyBaseN/AISS
GO:0009855GO-bp Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry SoyBaseN/AISS
GO:0009887GO-bp Annotation by Michelle Graham. GO Biological Process: organ morphogenesis SoyBaseN/AISS
GO:0010014GO-bp Annotation by Michelle Graham. GO Biological Process: meristem initiation SoyBaseN/AISS
GO:0010050GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative phase change SoyBaseN/AISS
GO:0010051GO-bp Annotation by Michelle Graham. GO Biological Process: xylem and phloem pattern formation SoyBaseN/AISS
GO:0010073GO-bp Annotation by Michelle Graham. GO Biological Process: meristem maintenance SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010267GO-bp Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference SoyBaseN/AISS
GO:0016246GO-bp Annotation by Michelle Graham. GO Biological Process: RNA interference SoyBaseN/AISS
GO:0016569GO-bp Annotation by Michelle Graham. GO Biological Process: covalent chromatin modification SoyBaseN/AISS
GO:0031047GO-bp Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA SoyBaseN/AISS
GO:0035196GO-bp Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA SoyBaseN/AISS
GO:0048439GO-bp Annotation by Michelle Graham. GO Biological Process: flower morphogenesis SoyBaseN/AISS
GO:0048519GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005719GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nuclear euchromatin SoyBaseN/AISS
GO:0035101GO-cc Annotation by Michelle Graham. GO Cellular Compartment: FACT complex SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
KOG0526 KOG Nucleosome-binding factor SPN, POB3 subunit JGI ISS
PTHR13711Panther SWI/SNF-RELATED CHROMATIN BINDING PROTEIN JGI ISS
PTHR13711:SF59Panther SUBFAMILY NOT NAMED JGI ISS
PF03531PFAM Structure-specific recognition protein (SSRP1) JGI ISS
UniRef100_O04235UniRef Annotation by Michelle Graham. Most informative UniRef hit: FACT complex subunit SSRP1 n=1 Tax=Vicia faba RepID=SSRP1_VICFA SoyBaseE_val: 0ISS
UniRef100_UPI000233992CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233992C related cluster n=1 Tax=unknown RepID=UPI000233992C SoyBaseE_val: 0ISS

Expression Patterns of Glyma03g03781
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g03781 not represented in the dataset
Glyma03g03781 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g03781
ParalogEvidenceComments
Glyma01g33240 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g03781 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g031900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g03781
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g03781
>Glyma03g03781.1   sequence type=CDS   gene model=Glyma03g03781   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTATCGCTGTTCGGCTCGTTGCAGCACTCAAACTCCTTCATTGCAGCTACACTCAACACCGTGTTTAGATGGAAGCCTAAGTTTTGCGGCAACTTTGGAAAATACTTCAAAAGTGCGTTCAAGTCTCACAAAACGGTGCATTGGAACACGTGTCAATGGATTAAAACGGTAAAACGAACACACCCTTGTTACTTGGACGTGGAAATTCACGTTCGCGCTCCTTTTTATCTTGGCATTGCGTTTGTGTGTGTGTGCAATATCACACAACCCAACCTTATTCGTTCTTCTGTTGTTCTGAGGCGAGCCATGACGGACGGTCATCTCTTCAACAACATCACCCTCGGTGGCCGTGGAGGCACCAATCCAGGGCAGATAAAAATATATCCTGGAGGAATTGTATGGAAGAGACAGGGTGGTGGTAAATTAATTGAAGTTGATAAATCTGACATAATGGGGGTGACATGGATGAAGGTACCAAGGAGTAACCAACTTGGTGTTCAAATCAAAGATGGGTTGTACTACAAGTTCACGGGATTTCGTGACCAGGATGTTGTAACTTTGACCAATTTTTTCCAAAACACCTGTGGAATATCAGTAGAAGAGAAGCAACTTTCTGTTAGCGGACGTAATTGGGGAGAAGTTGATCTAAATGGAAATATGCTGGCTTTCATGGTTGGTTCAAAGCAAGCTTTTGAAGTATCTTTAGCAGATGTCTCTCAAACACAGCTTCAAGGGAAGAATGATGTGATCTTGGAGTTTCATGTGGATGACACAACTGGAGCTAATGAGAAAGATTCACTGATGGAGATAAGTTTCCACATACCAAATTCCAACACCCAGTTTGTTGGTGATGAAAATCGTCCCCCTGCTCAGGTTTTCCGTGACAAAATTATGTCTATGGCTGATGTTGGTGCTGGAGGTGAAGATGCCATTGTTACATTTGAGGGTATTGCTATCCTTACGCCAAGAGGACGATACAGTGTTGAGTTACACATGTCATTCTTGCGGCTTCAAGGACAGGCTAATGATTTCAAAATCCAATATAGCAGTGTGGTTCGCCTATTTTTACTTCCTAAGTCTAATCAACCACATACCTTTGTCATTATTAGTCTTGATCCCCCTATTCGAAAGGGACAAACTTTGTACCCTCATATTGTGATGCAGTTTGAAACTGATTATGTTGTTGAAAGTGAATTGGCAATAAATGAAGATCTTTATAACACAAAGTTCAAGGACAAGTTGGAGCTGTCTTATAAGGGTCTTATTCATGAAGTGTTCACCACAATATTACGTGGTTTGTCTGGTGCCAAAGTGACCAAGCCCGGAAAATTTAGGAGTTGTCAAGATGGTTATGCAGTGAAATCATCTTTGAAAGCTGAAGATGGAATTCTGTATCCCCTTGAGAAGAGCTTCTTCTTTCTACCTAAACCTCCCACTCTTATTCTTCATGAAGAGATTGACTATGTGGAATTTGAGCGGCATGCTGCTGGTGGCTCCAATATGCATTATTTTGACCTTCTTATCAGACTAAAATCTGAACAAGAGCATCTCTTCCGTAATATTCAGAGAAATGAGTACCACAATTTGTATGAATTTATCAGTTCAAAGGGCTTGAAAATTATGAACTTAGGAGATGCCCAACCTACTGTTGGTATAAAGAAGGTTCTTGAGAATGATGATGATGATGCTGTTGATCCACATCTTGAGCGCATAAAAAATGAAGCTGGTGAAGATGAAAGTGATGAGGAGGATTCTGATTTTGTTGCTGACAAGGATGATGAAGGTTCTCCTACTGATGATTCTGGGGCAGACGATTCTGATGCCACTGATAGTGGTGATGAGAAAGAGAAGCCTGCCAAAAAGGAATCAAACAAGGGCTCTCCCTCTTAG
Predicted protein sequences of Glyma03g03781
>Glyma03g03781.1   sequence type=predicted peptide   gene model=Glyma03g03781   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLSLFGSLQHSNSFIAATLNTVFRWKPKFCGNFGKYFKSAFKSHKTVHWNTCQWIKTVKRTHPCYLDVEIHVRAPFYLGIAFVCVCNITQPNLIRSSVVLRRAMTDGHLFNNITLGGRGGTNPGQIKIYPGGIVWKRQGGGKLIEVDKSDIMGVTWMKVPRSNQLGVQIKDGLYYKFTGFRDQDVVTLTNFFQNTCGISVEEKQLSVSGRNWGEVDLNGNMLAFMVGSKQAFEVSLADVSQTQLQGKNDVILEFHVDDTTGANEKDSLMEISFHIPNSNTQFVGDENRPPAQVFRDKIMSMADVGAGGEDAIVTFEGIAILTPRGRYSVELHMSFLRLQGQANDFKIQYSSVVRLFLLPKSNQPHTFVIISLDPPIRKGQTLYPHIVMQFETDYVVESELAINEDLYNTKFKDKLELSYKGLIHEVFTTILRGLSGAKVTKPGKFRSCQDGYAVKSSLKAEDGILYPLEKSFFFLPKPPTLILHEEIDYVEFERHAAGGSNMHYFDLLIRLKSEQEHLFRNIQRNEYHNLYEFISSKGLKIMNLGDAQPTVGIKKVLENDDDDAVDPHLERIKNEAGEDESDEEDSDFVADKDDEGSPTDDSGADDSDATDSGDEKEKPAKKESNKGSPS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo