SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g03500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g03500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g03500

Feature Type:gene_model
Chromosome:Gm03
Start:3273351
stop:3276534
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G45190AT Annotation by Michelle Graham. TAIR10: Plant-specific transcription factor YABBY family protein | chr2:18628450-18630552 REVERSE LENGTH=229 SoyBaseE_val: 8.00E-96ISS
GO:0006333GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin assembly or disassembly SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0009944GO-bp Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010093GO-bp Annotation by Michelle Graham. GO Biological Process: specification of floral organ identity SoyBaseN/AISS
GO:0010103GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis SoyBaseN/AISS
GO:0010154GO-bp Annotation by Michelle Graham. GO Biological Process: fruit development SoyBaseN/AISS
GO:0010158GO-bp Annotation by Michelle Graham. GO Biological Process: abaxial cell fate specification SoyBaseN/AISS
GO:0010159GO-bp Annotation by Michelle Graham. GO Biological Process: specification of organ position SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010450GO-bp Annotation by Michelle Graham. GO Biological Process: inflorescence meristem growth SoyBaseN/AISS
GO:0016226GO-bp Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly SoyBaseN/AISS
GO:0045165GO-bp Annotation by Michelle Graham. GO Biological Process: cell fate commitment SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF04690PFAM YABBY protein JGI ISS
UniRef100_I1JKS4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JKS4_SOYBN SoyBaseE_val: 1.00E-159ISS
UniRef100_Q6SS00UniRef Annotation by Michelle Graham. Most informative UniRef hit: YABBY-like transcription factor GRAMINIFOLIA n=1 Tax=Antirrhinum majus RepID=Q6SS00_ANTMA SoyBaseE_val: 1.00E-123ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g03500 not represented in the dataset

Glyma03g03500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma01g33370 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g029800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g03500.1   sequence type=CDS   gene model=Glyma03g03500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCTCCTCATCCACTTCCTTTTCACCGGACCAACAACACCTCTCTCCCTCCGACCAGCTCTGCTATGTCCATTGCAACTTCTGTGACACTGTCCTCGCGGTGAGTGTTCCTTGCACCAGCTTGTTCAAGAATGTCACTGTGAGATGTGGTCATTGCACCAACCTTCTCTCAGTCAACATGCGTGGACTGCTTCTTCCCAGTGCCAATCAGCTTCACCTTGGCCACACTTTCTTCACTCCTCAAAATCTTATGGAGGAGATTCGTAATGCACCTTCAACAAACATAATGATGAATCAGCTGCCGAACCCTAATGATTTGGTCATGAGCACCATGAGAGGAGGGCCTGAAGAAACCCCTAAGCCTCCATCAGCTAATAGACCTCCAGAGAAGAGACAGCGAGTTCCGTCTGCTTACAACCGCTTCATCAAGGATGAGATCCAACGTATCAAAGCTGGGAATCCTGATATAAGCCACAGAGAGGCCTTTAGTGCAGCTGCAAAGAATTGGGCCCATTTTCCACACATTCATTTCGGACTCATGCCTGATAATCAACCCGTGAAGAAAGCTAATGTTCGTCAGGAAGCAGAGGACGTGCTTATGAAAGATGGGTTTTTCGCACCGGCTAATGTAGGCGTCTCTCCCTACTAG

>Glyma03g03500.1   sequence type=predicted peptide   gene model=Glyma03g03500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSSSTSFSPDQQHLSPSDQLCYVHCNFCDTVLAVSVPCTSLFKNVTVRCGHCTNLLSVNMRGLLLPSANQLHLGHTFFTPQNLMEEIRNAPSTNIMMNQLPNPNDLVMSTMRGGPEETPKPPSANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDNQPVKKANVRQEAEDVLMKDGFFAPANVGVSPY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo