SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g03490

Feature Type:gene_model
Chromosome:Gm03
Start:3254332
stop:3261723
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g03490
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G45200AT Annotation by Michelle Graham. TAIR10: golgi snare 12 | chr2:18637689-18639640 REVERSE LENGTH=239 SoyBaseE_val: 1.00E-153ISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0006891GO-bp Annotation by Michelle Graham. GO Biological Process: intra-Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0030244GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005802GO-cc Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0000149GO-mf Annotation by Michelle Graham. GO Molecular Function: SNARE binding SoyBaseN/AISS
KOG3208 KOG SNARE protein GS28 JGI ISS
PTHR21094Panther GOS-28 SNARE- RELATED JGI ISS
PF12352PFAM Snare region anchored in the vesicle membrane C-terminus JGI ISS
UniRef100_I1JKS2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Golgi SNAP receptor complex member 1 n=1 Tax=Glycine max RepID=I1JKS2_SOYBN SoyBaseE_val: 2.00E-174ISS
UniRef100_I1JKS2UniRef Annotation by Michelle Graham. Best UniRef hit: Golgi SNAP receptor complex member 1 n=1 Tax=Glycine max RepID=I1JKS2_SOYBN SoyBaseE_val: 2.00E-174ISS

Expression Patterns of Glyma03g03490
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g03490
ParalogEvidenceComments
Glyma01g33380 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g03490 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g029700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g03490
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g03490
>Glyma03g03490.1   sequence type=CDS   gene model=Glyma03g03490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGGATACGAATCTGGAGTTGCAGGAATCGGGTTGGGAGGAGCTGCGCAAGGAAGCGCGCAAGATCGAGGGTGATCTCGACGTCAAGCTCTCCTCCTACGCCAAACTCGGCGCTCGTTTCACCCAAGGAGGTTCAGGTTATGTAGATAGTGGTTCACCACCTATTGGGTCCAGTAGGTCTTGGAAGTCCATGGAAATGGAAATCCAGTCTTTACTCGAGAAACTGTTGGACATAAATGATTCAATGAGTAGATGTGCTGCATCTGCTGGGCCAGCTACTTCTGTAACTCAGAAGTTGGCTAGGCACAGAGACATTCTTCATGAGTTTACCCAGGAATTTAGACGTATCAAGGGGAACATAAACTCAATGAGGGAACATGCAGAGCTTTTGAGTTCTGTCAGGGATGATATTACTGACTTTAAGACATCAGGAAGTATGTCACCAAGGATGCAGTTACTACGTGAGAGAGCTTCCATCCATGGAAATATATCTCATATAGATGACGTGATTAGTCAAGCTCAAGCAACAAGGGCTGTGTTGGGTTCTCAGAGAACATTGTTTACTGATGTTCAAGGAAAAGTGAAGGTTCTTGGTGACAAGTTCCCCATGATTCGTAGCCTGCTTGGTTCGATAAGAAGGCGGCGCTCGAGGGATACTCTTATTCTGTCAGCAGTAATTGCTGCTTGTACGTTGTTTCTCATCATTTATTGGCTCTCAAAGTAA
Predicted protein sequences of Glyma03g03490
>Glyma03g03490.1   sequence type=predicted peptide   gene model=Glyma03g03490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRDTNLELQESGWEELRKEARKIEGDLDVKLSSYAKLGARFTQGGSGYVDSGSPPIGSSRSWKSMEMEIQSLLEKLLDINDSMSRCAASAGPATSVTQKLARHRDILHEFTQEFRRIKGNINSMREHAELLSSVRDDITDFKTSGSMSPRMQLLRERASIHGNISHIDDVISQAQATRAVLGSQRTLFTDVQGKVKVLGDKFPMIRSLLGSIRRRRSRDTLILSAVIAACTLFLIIYWLSK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo