Glyma03g03451 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g03451): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g03451): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g03451

Feature Type:	gene_model
Chromosome:	Gm03
Start:	3197245
stop:	3198319
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g03451

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G32760	AT	Annotation by Michelle Graham. TAIR10: ENTH/VHS/GAT family protein \| chr4:15799376-15803832 FORWARD LENGTH=675	SoyBase	E_val: 1.00E-14	ISS
GO:0000902	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell morphogenesis	SoyBase	N/A	ISS
GO:0006487	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation	SoyBase	N/A	ISS
GO:0006623	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole	SoyBase	N/A	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0006891	GO-bp	Annotation by Michelle Graham. GO Biological Process: intra-Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0016049	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell growth	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005795	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi stack	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0008565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein transporter activity	SoyBase	N/A	ISS
PTHR13856	Panther	VHS DOMAIN CONTAINING PROTEIN FAMILY	JGI		ISS
PTHR13856:SF27	Panther	TARGET OF MYB1 RELATED (TOM1 - RELATED)	JGI		ISS
PF00790	PFAM	VHS domain	JGI		ISS
UniRef100_Q2V732	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: VHS and GAT domain protein n=2 Tax=Glycine max RepID=Q2V732_SOYBN	SoyBase	E_val: 1.00E-14	ISS
UniRef100_UPI000233F323	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233F323 related cluster n=1 Tax=unknown RepID=UPI000233F323	SoyBase	E_val: 5.00E-33	ISS

Expression Patterns of Glyma03g03451

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g03451 not represented in the dataset	Glyma03g03451 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g03451 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g029300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g03451

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g03451

Limit To All Plant Sequences

>Glyma03g03451.1   sequence type=CDS   gene model=Glyma03g03451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAATTCCATGGTGGAACGTGCCACGAGCGACATGCTCATAGGGCCTGATTGGGCCATGAACATCGAGATCTGCGACATGCTCAATCATGACCCTTGGTGCGTTTTCCTTTTTTGCACTCTTTCATCCAAAGTGCACCGTTTTTCTCTAATCCCCCAAATGCGAATCATCTTTTTTTGTTTGTTTTTTTTATCATTTTTCCTCAAGCTGAAAATGCATAGTCCGTCTCAGAGACTCATAGGAGCCGAACAAATCGTCGCTCAGAGAGGAAAATTGTGTGTCGTTTCGCCTTCTTCTGGGATCTCCGTCGTCGATGTGGCGACAGTGCCGCCACGGATTTTGCCGATTTGGCTGCCGGAAGAGTTCGAGCCAGTGGTCGTTCACATCTTAAACATCTTTGCTCTATTTTGA

Predicted protein sequences of Glyma03g03451

Limit To All Plant Sequences

>Glyma03g03451.1   sequence type=predicted peptide   gene model=Glyma03g03451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVNSMVERATSDMLIGPDWAMNIEICDMLNHDPWCVFLFCTLSSKVHRFSLIPQMRIIFFCLFFLSFFLKLKMHSPSQRLIGAEQIVAQRGKLCVVSPSSGISVVDVATVPPRILPIWLPEEFEPVVVHILNIFALF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain