SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g03210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g03210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g03210

Feature Type:gene_model
Chromosome:Gm03
Start:3001993
stop:3005606
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G45280AT Annotation by Michelle Graham. TAIR10: RAS associated with diabetes protein 51C | chr2:18670103-18672041 FORWARD LENGTH=363 SoyBaseE_val: 2.00E-164ISS
GO:0000724GO-bp Annotation by Michelle Graham. GO Biological Process: double-strand break repair via homologous recombination SoyBaseN/AISS
GO:0006261GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication SoyBaseN/AISS
GO:0006275GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication SoyBaseN/AISS
GO:0006281GO-bp Annotation by Michelle Graham. GO Biological Process: DNA repair SoyBaseN/AISS
GO:0006306GO-bp Annotation by Michelle Graham. GO Biological Process: DNA methylation SoyBaseN/AISS
GO:0006310GO-bp Annotation by Michelle Graham. GO Biological Process: DNA recombination SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006396GO-bp Annotation by Michelle Graham. GO Biological Process: RNA processing SoyBaseN/AISS
GO:0006626GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion SoyBaseN/AISS
GO:0007129GO-bp Annotation by Michelle Graham. GO Biological Process: synapsis SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0007140GO-bp Annotation by Michelle Graham. GO Biological Process: male meiosis SoyBaseN/AISS
GO:0007143GO-bp Annotation by Michelle Graham. GO Biological Process: female meiosis SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0009560GO-bp Annotation by Michelle Graham. GO Biological Process: embryo sac egg cell differentiation SoyBaseN/AISS
GO:0010212GO-bp Annotation by Michelle Graham. GO Biological Process: response to ionizing radiation SoyBaseN/AISS
GO:0016444GO-bp Annotation by Michelle Graham. GO Biological Process: somatic cell DNA recombination SoyBaseN/AISS
GO:0022402GO-bp Annotation by Michelle Graham. GO Biological Process: cell cycle process SoyBaseN/AISS
GO:0031047GO-bp Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA SoyBaseN/AISS
GO:0043687GO-bp Annotation by Michelle Graham. GO Biological Process: post-translational protein modification SoyBaseN/AISS
GO:0045003GO-bp Annotation by Michelle Graham. GO Biological Process: double-strand break repair via synthesis-dependent strand annealing SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0000150GO-mf Annotation by Michelle Graham. GO Molecular Function: recombinase activity SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003684GO-mf Annotation by Michelle Graham. GO Molecular Function: damaged DNA binding SoyBaseN/AISS
GO:0003697GO-mf Annotation by Michelle Graham. GO Molecular Function: single-stranded DNA binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008094GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA-dependent ATPase activity SoyBaseN/AISS
KOG1434 KOG Meiotic recombination protein Dmc1 JGI ISS
PTHR22942Panther RECA/RAD51/RADA DNA STRAND-PAIRING FAMILY MEMBER JGI ISS
PTHR22942:SF14Panther DNA REPAIR PROTEIN RAD51 HOMOLOG 3, R51H3 JGI ISS
PF08423PFAM Rad51 JGI ISS
UniRef100_G7JS17UniRef Annotation by Michelle Graham. Most informative UniRef hit: DNA repair protein RAD51-like protein n=1 Tax=Medicago truncatula RepID=G7JS17_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1JKP9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JKP9_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g03210 not represented in the dataset

Glyma03g03210 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g027600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g03210.2   sequence type=CDS   gene model=Glyma03g03210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGTGGGTATGCTTCCAATCTCAGCTTCAAAGAGAGGAAAACTCTTGGCTGCTGGTTACACCACTCTCGATGCCATTGCTCGTGCCTCCCCCACCCACCTTGCTCGAGATATTGATGTTTCTGAGAGTGAAGCCACGGAAATTCTGAATCTTGCAAGCAAACCTAGTGCTTTGGAGAGACCGAATGGGTCTCACACTGCTGTTGTTGGTGGTGGTCAGACTGCCTGGGATATGCTCAATGATGAAAAGTTTTCTTCTTACATTACCACATCTTGTGCAGATCTGGATAACATCCTTGGTGGAGGAATTAAGTGCAAAGAAGTCACTGAAATAGGTGGAGTTCCAGGCATTGGTAAAACACAAATTGGGATTCAACTTGCGGTAAATGTTCAGATTCCACAAGAATATGGTGGCCTAGGAGGGAAGGCAATATACATCGCTTTATGGTTGAACCGTGTTCTACAAATTGCTGAAGCATGCAAAGAAGATATGGCAGAATACAGCCGGCACTTTCATAAGGATTTTCAAGCTTGTGATGTTAAAATGCACCCTAATAATATCTTGGAAAATATATTCTATTTTCGTGTTTGCAGCTACACTGAGCAAATTGCTTTGATAAATTACTTGGACAAATTCATCACAGAGAATAAAGATGTAAAGATCCTCATTGTTGACAGTGTTACTTTCCACTTCCGCCAAGACTTTGATGATATGGCTCTCAGGACTCGATTACTCAGTGAAATGGCTTTGAAGTTGATGAAGCTTGCAAAAAAATTCCGTTTGGCTGTTGTTATGTTCAATCAAGTAACAACCAAGCATATTGAAGGTTCATTTCAATTGACCCTTGCACTAGGAGATAGTTGGTCGCATTCATGCACAAATAGGATAATCTTGTTTTGGAATGGCAACGAACGACACGCATTTATCGACAAGTCCCCTTCTCTGAAATCAGCATCAGCTCCATATTCTGTGACAACTAGAGGGATACGCAATTCTACTTCAAGCTGCAAACGAATCAAGATGATGTGA

>Glyma03g03210.2   sequence type=predicted peptide   gene model=Glyma03g03210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEVGMLPISASKRGKLLAAGYTTLDAIARASPTHLARDIDVSESEATEILNLASKPSALERPNGSHTAVVGGGQTAWDMLNDEKFSSYITTSCADLDNILGGGIKCKEVTEIGGVPGIGKTQIGIQLAVNVQIPQEYGGLGGKAIYIALWLNRVLQIAEACKEDMAEYSRHFHKDFQACDVKMHPNNILENIFYFRVCSYTEQIALINYLDKFITENKDVKILIVDSVTFHFRQDFDDMALRTRLLSEMALKLMKLAKKFRLAVVMFNQVTTKHIEGSFQLTLALGDSWSHSCTNRIILFWNGNERHAFIDKSPSLKSASAPYSVTTRGIRNSTSSCKRIKMM*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo