Glyma03g02861 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g02861): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g02861): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g02861

Feature Type:	gene_model
Chromosome:	Gm03
Start:	2690444
stop:	2690961
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g02861

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G01480	AT	Annotation by Michelle Graham. TAIR10: 1-amino-cyclopropane-1-carboxylate synthase 2 \| chr1:175862-178051 FORWARD LENGTH=496	SoyBase	E_val: 2.00E-44	ISS
GO:0009058	GO-bp	Annotation by Michelle Graham. GO Biological Process: biosynthetic process	SoyBase	N/A	ISS
GO:0009693	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process	SoyBase	N/A	ISS
GO:0042218	GO-bp	Annotation by Michelle Graham. GO Biological Process: 1-aminocyclopropane-1-carboxylate biosynthetic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0016740	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity	SoyBase	N/A	ISS
GO:0016847	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 1-aminocyclopropane-1-carboxylate synthase activity	SoyBase	N/A	ISS
GO:0030170	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pyridoxal phosphate binding	SoyBase	N/A	ISS
PTHR11751	Panther	SUBGROUP I AMINOTRANSFERASE RELATED	JGI		ISS
PTHR11751:SF26	Panther	TRANSCRIPTION REGULATOR AMINOTRANSFERASE GNTR-RELATED	JGI		ISS
PF00155	PFAM	Aminotransferase class I and II	JGI		ISS
UniRef100_G7L6P5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 1-aminocyclopropane-1-carboxylate synthase n=2 Tax=Medicago truncatula RepID=G7L6P5_MEDTR	SoyBase	E_val: 6.00E-56	ISS
UniRef100_UPI00023397BA	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023397BA related cluster n=1 Tax=unknown RepID=UPI00023397BA	SoyBase	E_val: 9.00E-87	ISS

Expression Patterns of Glyma03g02861

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g02861 not represented in the dataset	Glyma03g02861 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g02861 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g025100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g02861

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g02861

Limit To All Plant Sequences

>Glyma03g02861.1   sequence type=CDS   gene model=Glyma03g02861   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTCAAGAGTGGATAAGGAACAATCCTAAGGCCTCCATTTGCACTGCTGAAGGAGTAAACCAGTTCAAATATATTGCAAACTTTCAAGACTATCATGGATTGCCAGAGTTCAGAAATGCTGTGGCAAATTTCATGTCAGAAGTGAGAGGTGGGAGAGTGAGATTTGATCCTGACCGTATATTGATGAGTGGAGGGGCCACAGGAGCAAACGAGCTAATAATGTTCTGTTTGGCTGATGCTGGAGATGCTTTTCTGGTTCCTAGCCTTTATTATCCAGCATATGTGCCCTCTCTTTCATCACGCCTGTTTTCATTCAATGAATCACACTATTTCACACCCATCAAAACGTTAAAAGTGGACACAAATTAA

Predicted protein sequences of Glyma03g02861

Limit To All Plant Sequences

>Glyma03g02861.1   sequence type=predicted peptide   gene model=Glyma03g02861   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIQEWIRNNPKASICTAEGVNQFKYIANFQDYHGLPEFRNAVANFMSEVRGGRVRFDPDRILMSGGATGANELIMFCLADAGDAFLVPSLYYPAYVPSLSSRLFSFNESHYFTPIKTLKVDTN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain