|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G23090 | AT | Annotation by Michelle Graham. TAIR10: sulfate transporter 91 | chr1:8185238-8188954 REVERSE LENGTH=631 | SoyBase | E_val: 1.00E-32 | ISS |
| GO:0006810 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transport | SoyBase | N/A | ISS |
| GO:0008272 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sulfate transport | SoyBase | N/A | ISS |
| GO:0055085 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transmembrane transport | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0016021 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane | SoyBase | N/A | ISS |
| GO:0005215 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transporter activity | SoyBase | N/A | ISS |
| GO:0008271 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: secondary active sulfate transmembrane transporter activity | SoyBase | N/A | ISS |
| GO:0015116 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sulfate transmembrane transporter activity | SoyBase | N/A | ISS |
| PTHR11814 | Panther | SULFATE TRANSPORTER | JGI | ISS | |
| PTHR11814:SF46 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| PF00916 | PFAM | Sulfate transporter family | JGI | ISS | |
| UniRef100_B9GEK7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Sulfate/bicarbonate/oxalate exchanger and transporter sat-1 n=1 Tax=Populus trichocarpa RepID=B9GEK7_POPTR | SoyBase | E_val: 7.00E-31 | ISS |
| UniRef100_I1KM59 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KM59_SOYBN | SoyBase | E_val: 2.00E-41 | ISS |
|
Glyma03g02826 not represented in the dataset |
Glyma03g02826 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.03g024700 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma03g02826.1 sequence type=CDS gene model=Glyma03g02826 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCTCACAGAGGAAGTGTCTCCCAGTGAACAACCTGATCTTTTTCTTCAATTAGCTTTAACTTCAACATTCTTTGCTGGGATCTTTCAAGCCGCTCTTGGAATTCTAAGGCTAGGATTTATCATTGATTTTCTATCAAAGGCAATCCTTATTGGATTCATGGTTGGATCAGCTGTAATTGTAGCTTTGCAACAGCTCAAGGGCCTTCATGGAATCAAACATTTCACCAAAAAGATGCAACAGCTCAAGGACTAA
>Glyma03g02826.1 sequence type=predicted peptide gene model=Glyma03g02826 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLTEEVSPSEQPDLFLQLALTSTFFAGIFQAALGILRLGFIIDFLSKAILIGFMVGSAVIVALQQLKGLHGIKHFTKKMQQLKD*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||