SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma03g02631

Feature Type:gene_model
Chromosome:Gm03
Start:2435337
stop:2440211
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G00210AT Annotation by Michelle Graham. TAIR10: LOB domain-containing protein 31 | chr4:85693-86888 REVERSE LENGTH=220 SoyBaseE_val: 5.00E-66ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
PF03195PFAM Protein of unknown function DUF260 JGI ISS
UniRef100_B9RDE0UniRef Annotation by Michelle Graham. Most informative UniRef hit: LOB domain-containing protein, putative n=1 Tax=Ricinus communis RepID=B9RDE0_RICCO SoyBaseE_val: 3.00E-77ISS
UniRef100_UPI00023370ABUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023370AB related cluster n=1 Tax=unknown RepID=UPI00023370AB SoyBaseE_val: 5.00E-122ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g02631 not represented in the dataset

Glyma03g02631 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma01g34523 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g023100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g02631.1   sequence type=CDS   gene model=Glyma03g02631   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTGTGGTGGTAATAAGAATACTGGTGGAAGTGAAAGGGGTGATGGGCCTTGTGGTGCCTGCAAGTTTCTGAGGAGAAAGTGTGTGAAGGGTTGCATTTTTGCACCATACTTTGACTCAGACCAAGGAACGGCTCATTTTGCTGCGGTGCACAAGGTCTTTGGTGCTAGCAATGCCTCCAAGTTACTCATGAGGATTCCAGCACACAAAAGACTTGATGCTGTTGTTACTCTTTGCTATGAGGCTTTGTCTAGGGCTAGAGACCCCGTTTATGGTTGTGTTGGTCACCTCTTTGCTCTTCAACAACAGGTCATGAACTTGCAGGCTGAGTTAACCTATGTCCAGGCCCATCTCGCAACGATGCAGCGATTGCCAGTGAAAGTGGCTCCTCTTCCTCCACATCCTCAAAGCTCTTCACCACCACCAACCCTTCATTCCTCAGATCACATGGCACCAAATGCTGACTTGCAAAGTGCCCCTATGATGCACTTTGGTCCTCTTCAACCACATTCAGCATCATTGCCGCTAGGCAGCATCGTTTTCGATCAATCGAATCGACAACTCGACGATAGGGAACTCCGAGTTCTGGCTCGAGAATTTGTGAGCAAATACTTGCCCGGAGTTAGATTCCAGTAA

>Glyma03g02631.1   sequence type=predicted peptide   gene model=Glyma03g02631   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDCGGNKNTGGSERGDGPCGACKFLRRKCVKGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLMRIPAHKRLDAVVTLCYEALSRARDPVYGCVGHLFALQQQVMNLQAELTYVQAHLATMQRLPVKVAPLPPHPQSSSPPPTLHSSDHMAPNADLQSAPMMHFGPLQPHSASLPLGSIVFDQSNRQLDDRELRVLAREFVSKYLPGVRFQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo