Glyma03g02240 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g02240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g02240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g02240

Feature Type:	gene_model
Chromosome:	Gm03
Start:	1998243
stop:	2000563
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g02240

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G45640	AT	Annotation by Michelle Graham. TAIR10: SIN3 associated polypeptide P18 \| chr2:18799881-18801323 REVERSE LENGTH=152	SoyBase	E_val: 1.00E-63	ISS
GO:0009062	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
KOG3391	KOG	Transcriptional co-repressor component	JGI		ISS
PTHR13082	Panther	SAP18	JGI		ISS
PF06487	PFAM	Sin3 associated polypeptide p18 (SAP18)	JGI		ISS
UniRef100_C6T2R6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2R6_SOYBN	SoyBase	E_val: 3.00E-104	ISS
UniRef100_G7ZXR9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Histone deacetylase complex subunit SAP18 n=1 Tax=Medicago truncatula RepID=G7ZXR9_MEDTR	SoyBase	E_val: 4.00E-80	ISS

Expression Patterns of Glyma03g02240

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g02240 not represented in the dataset	Glyma03g02240 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g02240 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g019600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g02240

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g02240

Limit To All Plant Sequences

>Glyma03g02240.1   sequence type=CDS   gene model=Glyma03g02240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCGACGGAGGAAAACGACAAGGTGGAAGAGCGTTGCCGCCGCCGCCAAGAGGCCCTCCGCCTCCTCCCCCCTCTCGCCCTCGCCTCGAACCCGTCGATCGCGAAAAGACATGTCCGTTACTGCTGCGAGTGTTCACTAAGATTGGGAGTCACCATTCCATGGAAGACTTTGCCGTCAGAGGCAAAGAGCCCAAAGACGAGGTTCAGATTTACACCTGGAAGGACGCTACTCTCCGAGAACTCACCGATCTTGTCAAAGAAGTTGCTCCGGCTGCAAGGAGAAGAAACGCCAAACTCTCCTTCGCCTTTGTATTCCCCGACAAAAACGGCCGTTTCAAAGTTCAAGAGGTGGGCAAGACATTATCTTATGGAAATGGAAGATTAGATGATGGCAAGGCTTTAGCCGAACTTGGTTTTGAAATCGGTGACTACTTGGATGTGGCTATTCTGTAG

Predicted protein sequences of Glyma03g02240

Limit To All Plant Sequences

>Glyma03g02240.1   sequence type=predicted peptide   gene model=Glyma03g02240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSDGGKRQGGRALPPPPRGPPPPPPSRPRLEPVDREKTCPLLLRVFTKIGSHHSMEDFAVRGKEPKDEVQIYTWKDATLRELTDLVKEVAPAARRRNAKLSFAFVFPDKNGRFKVQEVGKTLSYGNGRLDDGKALAELGFEIGDYLDVAIL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain