SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g01941): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g01941): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g01941

Feature Type:gene_model
Chromosome:Gm03
Start:1733772
stop:1735578
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G06850AT Annotation by Michelle Graham. TAIR10: xyloglucan endotransglucosylase/hydrolase 4 | chr2:2763619-2765490 FORWARD LENGTH=296 SoyBaseE_val: 5.00E-15ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0006073GO-bp Annotation by Michelle Graham. GO Biological Process: cellular glucan metabolic process SoyBaseN/AISS
GO:0007389GO-bp Annotation by Michelle Graham. GO Biological Process: pattern specification process SoyBaseN/AISS
GO:0008361GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell size SoyBaseN/AISS
GO:0009612GO-bp Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus SoyBaseN/AISS
GO:0009645GO-bp Annotation by Michelle Graham. GO Biological Process: response to low light intensity stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009826GO-bp Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010015GO-bp Annotation by Michelle Graham. GO Biological Process: root morphogenesis SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
GO:0016762GO-mf Annotation by Michelle Graham. GO Molecular Function: xyloglucan:xyloglucosyl transferase activity SoyBaseN/AISS
GO:0016798GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on glycosyl bonds SoyBaseN/AISS
PTHR10963Panther SECRETED GLUCOSIDASE-RELATED JGI ISS
PTHR10963:SF14Panther BETA-GLUCANASE JGI ISS
PF00722PFAM Glycosyl hydrolases family 16 JGI ISS
UniRef100_B6TNS1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Xyloglucan endotransglucosylase/hydrolase protein 5 n=1 Tax=Zea mays RepID=B6TNS1_MAIZE SoyBaseE_val: 1.00E-36ISS
UniRef100_I1JKF2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1JKF2_SOYBN SoyBaseE_val: 2.00E-80ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g01941 not represented in the dataset

Glyma03g01941 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g08550 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g017400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g01941.1   sequence type=CDS   gene model=Glyma03g01941   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTACCTTGACACCATTGAGATTCCACCTCTAGTGAAGCAAAATTCTTCCATTTCCATGAAGCAAAAAGAGCCTGTTCCCACTGCGCCACCACCAACACCATCACCCTCACCTACTACCACCGCGGCGGCGTGCGGTGGCGCACCCCCCACCTGCTTTAACTCCGGCACGCTCTCCGCCCTCATCCGGTGCCCCTCCGGCGACACGAGCGGCCTCAACTTCAACCTCTACCTCTCCTCCCTGGAGGGAAACAAGTCCCAGGACGAGATCGACTTCGAGTTTCTCGGCCGCGACAGGAACATCGTACAAACAAACTACTTCTCCGAAGGTGTGGGAAACATGGAAAAGGTCCACGTTTTAGGGTTCGATGCTTCCGATGGGTTTCATGAGTATGGGATTGTGTGGGGGAGCGACGCGATCGAGTGGCGCGTGGATGGGAACCTGGTGAGAAGGCTATGTTTTTGTACGCTTCGATGTGGGATGCAAGTTGGGTTAATGAAGGGAAGTGGTGTGGGAAGTACTGTGGGACTGTTGTTGTTGAATGAGTCACTGCATTTTTTATTTGTAGTTGGAAATTTTACTGTATGTGTTGTTTCAGTGTAA

>Glyma03g01941.1   sequence type=predicted peptide   gene model=Glyma03g01941   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYLDTIEIPPLVKQNSSISMKQKEPVPTAPPPTPSPSPTTTAAACGGAPPTCFNSGTLSALIRCPSGDTSGLNFNLYLSSLEGNKSQDEIDFEFLGRDRNIVQTNYFSEGVGNMEKVHVLGFDASDGFHEYGIVWGSDAIEWRVDGNLVRRLCFCTLRCGMQVGLMKGSGVGSTVGLLLLNESLHFLFVVGNFTVCVVSV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo