Glyma03g01616 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g01616): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g01616): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g01616

Feature Type:	gene_model
Chromosome:	Gm03
Start:	1399893
stop:	1401404
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g01616

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G01790	AT	Annotation by Michelle Graham. TAIR10: K+ efflux antiporter 1 \| chr1:284781-290869 FORWARD LENGTH=1193	SoyBase	E_val: 2.00E-10	ISS
GO:0006812	GO-bp	Annotation by Michelle Graham. GO Biological Process: cation transport	SoyBase	N/A	ISS
GO:0006813	GO-bp	Annotation by Michelle Graham. GO Biological Process: potassium ion transport	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0008324	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cation transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015079	GO-mf	Annotation by Michelle Graham. GO Molecular Function: potassium ion transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015299	GO-mf	Annotation by Michelle Graham. GO Molecular Function: solute:hydrogen antiporter activity	SoyBase	N/A	ISS
GO:0015386	GO-mf	Annotation by Michelle Graham. GO Molecular Function: potassium:hydrogen antiporter activity	SoyBase	N/A	ISS
UniRef100_Q9ZTZ7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: K(+) efflux antiporter 1, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=KEA1_ARATH	SoyBase	E_val: 9.00E-08	ISS
UniRef100_UPI000233961D	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233961D related cluster n=1 Tax=unknown RepID=UPI000233961D	SoyBase	E_val: 4.00E-10	ISS

Expression Patterns of Glyma03g01616

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g01616 not represented in the dataset	Glyma03g01616 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g01616 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g014100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g01616

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g01616

Limit To All Plant Sequences

>Glyma03g01616.1   sequence type=CDS   gene model=Glyma03g01616   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGCAGGAATTTAGCATATTTAATGTTAAGTGTATCGAAATCCTATATATCATTGAGGTTTTGGTGACTGTTGTAGGTGTCGGATTAGTGGCTCATTATATTTGTGGGCAAGCTGGCCATGCTGCTATTGCCATTGGGAATGACCTGACATTATCATCAACTGTTGTTGTTCTGCGGGAAAATAACTTCACTTGTGTTTTCTTTTTGTAG

Predicted protein sequences of Glyma03g01616

Limit To All Plant Sequences

>Glyma03g01616.1   sequence type=predicted peptide   gene model=Glyma03g01616   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEQEFSIFNVKCIEILYIIEVLVTVVGVGLVAHYICGQAGHAAIAIGNDLTLSSTVVVLRENNFTCVFFL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain