SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g01240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g01240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g01240

Feature Type:gene_model
Chromosome:Gm03
Start:990020
stop:991161
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g01240
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G00700AT Annotation by Michelle Graham. TAIR10: C2 calcium/lipid-binding plant phosphoribosyltransferase family protein | chr4:286260-289369 FORWARD LENGTH=1006 SoyBaseE_val: 1.00E-98ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR16122Panther MCTP-RELATED JGI ISS
PTHR16122:SF13Panther SUBFAMILY NOT NAMED JGI ISS
PF08372PFAM Plant phosphoribosyltransferase C-terminal JGI ISS
UniRef100_I1JK92UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JK92_SOYBN SoyBaseE_val: 2.00E-142ISS
UniRef100_Q43085UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phosphoribosylanthranilate transferase (Fragment) n=1 Tax=Pisum sativum RepID=Q43085_PEA SoyBaseE_val: 1.00E-119ISS

Expression Patterns of Glyma03g01240
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g01240 not represented in the dataset
Glyma03g01240 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g01240 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g010200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g01240
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g01240
>Glyma03g01240.2   sequence type=CDS   gene model=Glyma03g01240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAGTGTTTTCTGGAATTCTCTCAGTTGTAAGATGGTTAGGGGAAGTTTCCACATGGAAGCATCCTATAACAACAGTGCTGGTGCACATTCTTTTTCTGATGCTTGTGTGTTTCCCTGAACTTATACTGCCAACCGTGTTTCTATACATGTTTGTCATCGGCATGTGGAATTGGAGGTTCCGGCCAAGGTGCCCTCCTCACATGAACATCAGACTCTCCTATGCAGAAAGGGTGACCCCGGATGAGCTTGACGAGGAATTTGACACATTCCCCACCTCAAAGAGCCCCGACATTCTACGTTGGAGGTACGATCGGTTAAGAAGTGTGGCTGGGAGGATCCAGAGTGTTGTTGGAGATTTAGCTACTCAAGGAGAGAGGATCCAAGCTCTTGTGAACTGGCGTGATCCTCGTGCCACTGCCATGTTCATGGTATTTTGCTTCGTGGCTGCTATTGCGTTGTATGTCACACCCTTCCAGCTGCCTATTCTTCTGACTGGATTCTACTTGATGAGGCACCCCATGCTTCGAAGCAAGGTGCCGCCTGCTCCGGTTAATTTCTTCCGCAGGTTGCCTTCTCTCACAGACAGCATGCTGTAA
Predicted protein sequences of Glyma03g01240
>Glyma03g01240.2   sequence type=predicted peptide   gene model=Glyma03g01240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTVFSGILSVVRWLGEVSTWKHPITTVLVHILFLMLVCFPELILPTVFLYMFVIGMWNWRFRPRCPPHMNIRLSYAERVTPDELDEEFDTFPTSKSPDILRWRYDRLRSVAGRIQSVVGDLATQGERIQALVNWRDPRATAMFMVFCFVAAIALYVTPFQLPILLTGFYLMRHPMLRSKVPPAPVNFFRRLPSLTDSML*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo