SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma03g00960

Feature Type:gene_model
Chromosome:Gm03
Start:658488
stop:661889
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G03240AT Annotation by Michelle Graham. TAIR10: frataxin homolog | chr4:1423685-1424758 REVERSE LENGTH=187 SoyBaseE_val: 3.00E-64ISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0009060GO-bp Annotation by Michelle Graham. GO Biological Process: aerobic respiration SoyBaseN/AISS
GO:0009790GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0048825GO-bp Annotation by Michelle Graham. GO Biological Process: cotyledon development SoyBaseN/AISS
GO:0051301GO-bp Annotation by Michelle Graham. GO Biological Process: cell division SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0004322GO-mf Annotation by Michelle Graham. GO Molecular Function: ferroxidase activity SoyBaseN/AISS
PTHR16821Panther FRATAXIN JGI ISS
PF01491PFAM Frataxin-like domain JGI ISS
UniRef100_G7KHT5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Frataxin-like protein n=2 Tax=Medicago truncatula RepID=G7KHT5_MEDTR SoyBaseE_val: 3.00E-82ISS
UniRef100_I1JK59UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JK59_SOYBN SoyBaseE_val: 1.00E-137ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma19g29700 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g007300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g00960.1   sequence type=CDS   gene model=Glyma03g00960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCAAAGCTGCTTTTGCAGAGAAGGCTCTTTAGGTTTCTGCAACTGTCACCACCTTTTTTTTCTTCCATTCATGCAGCCCCAACAATCCTTTCTGCAAAAGCTTCAGAATTCATGTTTCTCTACAATGTGAATGCCCTTCTTCCTCCTCTCTCTCCTTCTAGAAACTTCTGCTCTCGCAGTTTTAACCTTCATGAATCTCAAGGCCCCCTGACTATTGATTACAGTTCTCTACTGCAGGAGGGTGAATTCCACAGACTGGCTGATTCCACAATACATAGCCTACAAGAGAAATTAGAGGACTATGGAGACTCAGTTGAAGTTGATGGATTTGACATAGATTATGGGAATGATGTTTTGACTATAAAACTTGGCGATCTTGGCACCTATGTGTTGAATAAACAAACACCAAATAGACAACTTTGGCTGTCTTCTCCTATGAGTGGTCCGTCAAGGTTTGATTGGGATCGGGATACAAAAGCTTGGATTTATAGGCGGAACAAAGCAAACTTGTATAAAATTTTGGAAGGGGAGTTGGAGCAGTTATGTGGCAAACCTATTGTTCTTTCTTAA

>Glyma03g00960.1   sequence type=predicted peptide   gene model=Glyma03g00960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASKLLLQRRLFRFLQLSPPFFSSIHAAPTILSAKASEFMFLYNVNALLPPLSPSRNFCSRSFNLHESQGPLTIDYSSLLQEGEFHRLADSTIHSLQEKLEDYGDSVEVDGFDIDYGNDVLTIKLGDLGTYVLNKQTPNRQLWLSSPMSGPSRFDWDRDTKAWIYRRNKANLYKILEGELEQLCGKPIVLS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo