Glyma03g00960 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g00960

Feature Type:	gene_model
Chromosome:	Gm03
Start:	658488
stop:	661889
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g00960

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G03240	AT	Annotation by Michelle Graham. TAIR10: frataxin homolog \| chr4:1423685-1424758 REVERSE LENGTH=187	SoyBase	E_val: 3.00E-64	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0009060	GO-bp	Annotation by Michelle Graham. GO Biological Process: aerobic respiration	SoyBase	N/A	ISS
GO:0009790	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0048825	GO-bp	Annotation by Michelle Graham. GO Biological Process: cotyledon development	SoyBase	N/A	ISS
GO:0051301	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell division	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0004322	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ferroxidase activity	SoyBase	N/A	ISS
PTHR16821	Panther	FRATAXIN	JGI		ISS
PF01491	PFAM	Frataxin-like domain	JGI		ISS
UniRef100_G7KHT5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Frataxin-like protein n=2 Tax=Medicago truncatula RepID=G7KHT5_MEDTR	SoyBase	E_val: 3.00E-82	ISS
UniRef100_I1JK59	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JK59_SOYBN	SoyBase	E_val: 1.00E-137	ISS

Expression Patterns of Glyma03g00960

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g00960

Paralog	Evidence	Comments
Glyma19g29700	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g00960 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g007300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g00960

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g00960

Limit To All Plant Sequences

>Glyma03g00960.1   sequence type=CDS   gene model=Glyma03g00960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCAAAGCTGCTTTTGCAGAGAAGGCTCTTTAGGTTTCTGCAACTGTCACCACCTTTTTTTTCTTCCATTCATGCAGCCCCAACAATCCTTTCTGCAAAAGCTTCAGAATTCATGTTTCTCTACAATGTGAATGCCCTTCTTCCTCCTCTCTCTCCTTCTAGAAACTTCTGCTCTCGCAGTTTTAACCTTCATGAATCTCAAGGCCCCCTGACTATTGATTACAGTTCTCTACTGCAGGAGGGTGAATTCCACAGACTGGCTGATTCCACAATACATAGCCTACAAGAGAAATTAGAGGACTATGGAGACTCAGTTGAAGTTGATGGATTTGACATAGATTATGGGAATGATGTTTTGACTATAAAACTTGGCGATCTTGGCACCTATGTGTTGAATAAACAAACACCAAATAGACAACTTTGGCTGTCTTCTCCTATGAGTGGTCCGTCAAGGTTTGATTGGGATCGGGATACAAAAGCTTGGATTTATAGGCGGAACAAAGCAAACTTGTATAAAATTTTGGAAGGGGAGTTGGAGCAGTTATGTGGCAAACCTATTGTTCTTTCTTAA

Predicted protein sequences of Glyma03g00960

Limit To All Plant Sequences

>Glyma03g00960.1   sequence type=predicted peptide   gene model=Glyma03g00960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASKLLLQRRLFRFLQLSPPFFSSIHAAPTILSAKASEFMFLYNVNALLPPLSPSRNFCSRSFNLHESQGPLTIDYSSLLQEGEFHRLADSTIHSLQEKLEDYGDSVEVDGFDIDYGNDVLTIKLGDLGTYVLNKQTPNRQLWLSSPMSGPSRFDWDRDTKAWIYRRNKANLYKILEGELEQLCGKPIVLS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain