SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g00880): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g00880): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g00880

Feature Type:gene_model
Chromosome:Gm03
Start:589123
stop:591096
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G10310AT Annotation by Michelle Graham. TAIR10: NAD(P)-binding Rossmann-fold superfamily protein | chr1:3381733-3383874 REVERSE LENGTH=242 SoyBaseE_val: 1.00E-123ISS
GO:0000038GO-bp Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid metabolic process SoyBaseN/AISS
GO:0006760GO-bp Annotation by Michelle Graham. GO Biological Process: folic acid-containing compound metabolic process SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0042335GO-bp Annotation by Michelle Graham. GO Biological Process: cuticle development SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016616GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor SoyBaseN/AISS
KOG0725 KOG Reductases with broad range of substrate specificities JGI ISS
PTHR24316Panther FAMILY NOT NAMED JGI ISS
PF00106PFAM short chain dehydrogenase JGI ISS
UniRef100_B9SPD4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Short-chain dehydrogenase, putative n=1 Tax=Ricinus communis RepID=B9SPD4_RICCO SoyBaseE_val: 3.00E-123ISS
UniRef100_I1JK52UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JK52_SOYBN SoyBaseE_val: 1.00E-170ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g00880 not represented in the dataset

Glyma03g00880 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g006500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g00880.1   sequence type=CDS   gene model=Glyma03g00880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGAACGGAGGAGGAAGACGACGAATCGTGCTGATAACTGGAGTCGGAAAAGGACTCGGAAGAGCCCTGGCTCTTGAACTCGCCCATCGTGGTCACACTATAATTGGCTGCTCCCGTTCTCAAGATAACCTCAATTCCCTCCAATCCCAACTCTCTTTTTCTTCTTCCAACCATTTGTTACTCAACGCCGACGTGAGCTCCAATGAGAACGTTCAAGAAATGGCCCGCGTTGTCATGGACAATAGATCTGTTCCTGATATCATAGTGAACAATGCAGGTACAATCAACAAGAACAACAAGATATGGGAGGTTCCGCCGGAGGACTTCGACGCGGTCATGGACACCAACGTCAAAGGCACGGCGAACGTGCTGCGGCACTTTATCCCTCTCATGATAGCCGCGAAGAAGATGGAGGCCGTCATTGTGAACATGTCCTCGGGATGGGGAAGGTCCGGCGCCGCGCTGGTGTCCCCTTACTGTGCCTCCAAGTGGGCCATTGAAGGGCTGAGCAAGTCCGTCGCGAAGGAGGTGCCGGAAGGGATTGCCGTGGTGGCGCTCAACCCCGGCGTGATCAACACCGACATGCTCGCCTCCTGCTTCGGGCCATCGGCTTTACTCTATCAGCAGCCGCAGGCGTGGGCTCTCAAGGCTGCAACCATGATTCTCAATCTCACCCCGGCTGACAATGGTGCCTCTCTCACTGTATGA

>Glyma03g00880.1   sequence type=predicted peptide   gene model=Glyma03g00880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMNGGGRRRIVLITGVGKGLGRALALELAHRGHTIIGCSRSQDNLNSLQSQLSFSSSNHLLLNADVSSNENVQEMARVVMDNRSVPDIIVNNAGTINKNNKIWEVPPEDFDAVMDTNVKGTANVLRHFIPLMIAAKKMEAVIVNMSSGWGRSGAALVSPYCASKWAIEGLSKSVAKEVPEGIAVVALNPGVINTDMLASCFGPSALLYQQPQAWALKAATMILNLTPADNGASLTV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo