SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g48090): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g48090): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g48090

Feature Type:gene_model
Chromosome:Gm02
Start:51536800
stop:51538308
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G35280AT Annotation by Michelle Graham. TAIR10: C2H2-like zinc finger protein | chr4:16787429-16788283 REVERSE LENGTH=284 SoyBaseE_val: 6.00E-66ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0030036GO-bp Annotation by Michelle Graham. GO Biological Process: actin cytoskeleton organization SoyBaseN/AISS
GO:0030048GO-bp Annotation by Michelle Graham. GO Biological Process: actin filament-based movement SoyBaseN/AISS
GO:0048235GO-bp Annotation by Michelle Graham. GO Biological Process: pollen sperm cell differentiation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR11389Panther ZINC FINGER PROTEIN JGI ISS
PTHR11389:SF378Panther gb def: gastrula zinc finger protein xlcgf46.1 JGI ISS
UniRef100_G7KFE8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cys2/His2 zinc-finger transcription factor n=1 Tax=Medicago truncatula RepID=G7KFE8_MEDTR SoyBaseE_val: 2.00E-66ISS
UniRef100_I1JJW1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JJW1_SOYBN SoyBaseE_val: 5.00E-173ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g48090 not represented in the dataset

Glyma02g48090 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g311100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g48090.1   sequence type=CDS   gene model=Glyma02g48090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAGGGAGTCTGATTGTGGCGAAGCGGGTTCTTCTTCTTGGTGTGTGGGAAAGAAGCAGAAGCAGAAGCGGTTAATGGAGGATGCAGGAGGGTGGAAGGGGAAGATATCATCATCATCGTCATCGTCGGAGCCACGTCCCTGTACCGAGTGCGGCAAGAAGTTCTGGTCGTGGAAGGCACTCTTCGGCCACATGAGATGCCACCCGGAGCGTCACTGGAGAGGGATCAATCCTCCGCCAAATGTGATCAGGAGACAACAACAAATGACCCAGGAAGACCACGAGGTCGCTGCCTGTTTGCTCCTGCTTGCCAACGCCAAAGACAAAGACAAAGACAAAGAGGAAGATGTTCATTTCGAGTGCTCCAGTTGCAACAAGGTGTTTGGGTCCCACCAGGCTCTTGGAGGACACCGTGCCAGTCACAAGAACGTAAAGGGCTGTTTTGCCAATAATGCTGCCATAGGAACGTCGTCTAGTACTAGTGATCAGGAGAACATGATGATTCTTCATGGTCACAAGTGCAGCATTTGCCTCAGGGTTTTCTCTACTGGTCAGGCACTTGGTGGCCACAAGAGGTGTCACTGGGACAAAGGGGACAACCTCGGTCTCCTTGCAGACTCGTCATCCAAGTCTCTCTCTCTCGTCGACTTGAATTTCCCTCCCCCTTCCTTCTCCTCCCCCCTCGCTCTCGATTTGAGGTTGGGACTCTAG

>Glyma02g48090.1   sequence type=predicted peptide   gene model=Glyma02g48090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKRESDCGEAGSSSWCVGKKQKQKRLMEDAGGWKGKISSSSSSSEPRPCTECGKKFWSWKALFGHMRCHPERHWRGINPPPNVIRRQQQMTQEDHEVAACLLLLANAKDKDKDKEEDVHFECSSCNKVFGSHQALGGHRASHKNVKGCFANNAAIGTSSSTSDQENMMILHGHKCSICLRVFSTGQALGGHKRCHWDKGDNLGLLADSSSKSLSLVDLNFPPPSFSSPLALDLRLGL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo