Glyma02g47960 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g47960

Feature Type:	gene_model
Chromosome:	Gm02
Start:	51374315
stop:	51376273
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g47960

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G61520	AT	Annotation by Michelle Graham. TAIR10: photosystem I light harvesting complex gene 3 \| chr1:22700152-22701149 FORWARD LENGTH=273	SoyBase	E_val: 8.00E-162	ISS
GO:0009765	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0019344	GO-bp	Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0010287	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0030076	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: light-harvesting complex	SoyBase	N/A	ISS
GO:0016168	GO-mf	Annotation by Michelle Graham. GO Molecular Function: chlorophyll binding	SoyBase	N/A	ISS
PTHR21649	Panther	CHLOROPHYLL A/B BINDING PROTEIN	JGI		ISS
PF00504	PFAM	Chlorophyll A-B binding protein	JGI		ISS
UniRef100_I1JJU8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JJU8_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q32904	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Chlorophyll a-b binding protein 3, chloroplastic n=1 Tax=Pisum sativum RepID=CB23_PEA	SoyBase	E_val: 4.00E-172	ISS

Expression Patterns of Glyma02g47960

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g47960

Paralog	Evidence	Comments
Glyma14g00640	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g47960 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g309500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g47960

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g47960

Limit To All Plant Sequences

>Glyma02g47960.1   sequence type=CDS   gene model=Glyma02g47960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGCACAAGCTCTTGTATCATCATCTTCTCTTACCTTCTCAGCGGAGGCTGCAAGACAAAGTCTTGGACCAAGATCACTCCAATCTCCATTTGGCTTCTCCAGAAAAGCCTCCTTTCTTGTTAAGGCAGCTGCTACCCCCCCTGTCAAGCAAGGATCAGACAGACCTTTGTGGTTTGCATCAAAGCAAAGTCTTTCTTACTTGGATGGCAGCCTTCCGGGTGACTATGGATTTGACCCTCTGGGACTTTCAGACCCTGAAGGAACAGGAGGGTTCATTGAGCCGAAATGGCTAGCATATGGTGAGATAATCAATGGTCGTTATGCAATGTTGGGTGCAGTTGGTGCAATAGCACCTGAAATTCTAGGCAAGGCTGGTCTGATCCCTCAGGAGACAGCACTCCCATGGTTCAGAACGGGTGTGTTCCCACCTGCAGGAACCTACAACTACTGGGCAGACTCCTACACACTGTTCGTGTTTGAGATGGCACTGATGGGATTTGCAGAGCACAGAAGATTCCAAGACTGGGCCAAACCAGGCTCTATGGGCAAACAATACTTCCTAGGACTAGAGAAGGGTCTTGGAGGTTCTGGTGAGCCAGCTTATCCAGGAGGACCTTTCTTCAACCCACTAGGCTTTGGTAAGGATGAGAAGTCCTTGAAGGATTTGAAGCTCAAGGAAGTGAAGAATGGAAGGTTGGCTATGTTGGCAATCTTGGGTTACTTTGTTCAAGCTCTTGTCACAGGTGTTGGCCCATACCAAAACCTCCTAGATCATTTGGCTGACCCCGTGCACAACAACATCTTGACCAGTCTCAAGTTCCACTGA

Predicted protein sequences of Glyma02g47960

Limit To All Plant Sequences

>Glyma02g47960.1   sequence type=predicted peptide   gene model=Glyma02g47960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAQALVSSSSLTFSAEAARQSLGPRSLQSPFGFSRKASFLVKAAATPPVKQGSDRPLWFASKQSLSYLDGSLPGDYGFDPLGLSDPEGTGGFIEPKWLAYGEIINGRYAMLGAVGAIAPEILGKAGLIPQETALPWFRTGVFPPAGTYNYWADSYTLFVFEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGLGGSGEPAYPGGPFFNPLGFGKDEKSLKDLKLKEVKNGRLAMLAILGYFVQALVTGVGPYQNLLDHLADPVHNNILTSLKFH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain