Glyma02g47830 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g47830

Feature Type:	gene_model
Chromosome:	Gm02
Start:	51296615
stop:	51297467
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g47830

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G04410	AT	Annotation by Michelle Graham. TAIR10: RPM1-interacting protein 4 (RIN4) family protein \| chr2:1534012-1535040 REVERSE LENGTH=73	SoyBase	E_val: 3.00E-18	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF05627	PFAM	Cleavage site for pathogenic type III effector avirulence factor Avr	JGI		ISS
UniRef100_B9T1T7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NOI, putative n=1 Tax=Ricinus communis RepID=B9T1T7_RICCO	SoyBase	E_val: 5.00E-21	ISS
UniRef100_I1JJT4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JJT4_SOYBN	SoyBase	E_val: 6.00E-53	ISS

Expression Patterns of Glyma02g47830

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g47830 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g308200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g47830

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g47830

Limit To All Plant Sequences

>Glyma02g47830.1   sequence type=CDS   gene model=Glyma02g47830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGAGAGGGGTAGAGCATTACCTAAGTTTGGGGACTGGGATGTGAATAATCCATCAGCAGCTCAGGATTTCTCAGTAATCTTCAACAAAGCCAGGAATGAGAGAAAGACTGGTGCTAATAAGATCCACTTTCCCCCAAATCATAATAACACAACAAAATGCAACCCCCCTCAAGTCGTTCTTGGCAAGTCCCATTATAAAAAATGGTTTTGCTGTATAAACACATCTGCAGAATCATGA

Predicted protein sequences of Glyma02g47830

Limit To All Plant Sequences

>Glyma02g47830.1   sequence type=predicted peptide   gene model=Glyma02g47830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAERGRALPKFGDWDVNNPSAAQDFSVIFNKARNERKTGANKIHFPPNHNNTTKCNPPQVVLGKSHYKKWFCCINTSAES*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain