SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g47730

Feature Type:gene_model
Chromosome:Gm02
Start:51229963
stop:51231724
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g47730
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G27820AT Annotation by Michelle Graham. TAIR10: Ribosomal L18p/L5e family protein | chr5:9860584-9860928 FORWARD LENGTH=114 SoyBaseE_val: 3.00E-63ISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PTHR12899Panther 39S RIBOSOMAL PROTEIN L18, MITOCHONDRIAL JGI ISS
PF00861PFAM Ribosomal L18p/L5e family JGI ISS
UniRef100_B6SMG7UniRef Annotation by Michelle Graham. Most informative UniRef hit: 50S ribosomal protein L18 n=1 Tax=Zea mays RepID=B6SMG7_MAIZE SoyBaseE_val: 3.00E-62ISS
UniRef100_I1JJR9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JJR9_SOYBN SoyBaseE_val: 1.00E-74ISS

Expression Patterns of Glyma02g47730
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g47730
ParalogEvidenceComments
Glyma14g00900 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g47730 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g307100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g47730
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g47730
>Glyma02g47730.1   sequence type=CDS   gene model=Glyma02g47730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTATCCCACCCCCAGTGAGGCCTCCCAGGATTACACAATTTCTCAAACCTTATGTTCTGAAGATGCATTTTACCAATAAGTATGTGAGTGCCCAGGTGATTCACACCCCAACTGCTACAGTAGCCTCTTCTGCAAGCTCACAGGAGAAAGCCTTGAGATCAAGCTTGGAAACTAGTCGCGATGTCGCTGCAGCTGCAAAGATTGGGAAGATACTAGCAGAACGCCTTTTGCTTAAGGACATTCCTGCAGTTTCTGTTCACTTGAAGAGAGAACAGAAGTATCATGGTAAGGTTAAAGCGGTTATTGATTCTATCAGGGAAGCTGGTGTTAAGCTGCTTTGA
Predicted protein sequences of Glyma02g47730
>Glyma02g47730.1   sequence type=predicted peptide   gene model=Glyma02g47730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVIPPPVRPPRITQFLKPYVLKMHFTNKYVSAQVIHTPTATVASSASSQEKALRSSLETSRDVAAAAKIGKILAERLLLKDIPAVSVHLKREQKYHGKVKAVIDSIREAGVKLL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo