Glyma02g47550 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g47550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g47550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g47550

Feature Type:	gene_model
Chromosome:	Gm02
Start:	51101684
stop:	51101959
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g47550

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G34110	AT	Annotation by Michelle Graham. TAIR10: poly(A) binding protein 2 \| chr4:16336732-16339892 FORWARD LENGTH=629	SoyBase	E_val: 5.00E-24	ISS
GO:0006413	GO-bp	Annotation by Michelle Graham. GO Biological Process: translational initiation	SoyBase	N/A	ISS
GO:0006486	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein glycosylation	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0003743	GO-mf	Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PTHR24011	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24011:SF69	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00076	PFAM	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	JGI		ISS
UniRef100_G7JK09	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Poly(A)-binding protein n=1 Tax=Medicago truncatula RepID=G7JK09_MEDTR	SoyBase	E_val: 2.00E-29	ISS
UniRef100_I1JE12	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JE12_SOYBN	SoyBase	E_val: 9.00E-34	ISS

Expression Patterns of Glyma02g47550

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g47550 not represented in the dataset	Glyma02g47550 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g47550 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma02g47550

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g47550

Limit To All Plant Sequences

>Glyma02g47550.1   sequence type=CDS   gene model=Glyma02g47550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCAAGTTCAGGTTCCGCCTCAGAATGCGTTCGTGACGACGTCGCTTTACGTTGGAGATCTCGACCCGAACATCATGGACGCCCAGCTGTATGATTTGTTCAACCAATTGGAACAAGTCATATCCGTTAGGGTTTGTAGGGACTTGACCACTAGGAGATCGCTCGGTTATGGTTATGTCAACTTTAGCAACCCGCAAGATGCTGTCGTCCTTCTCTCCTGTTACATATTCATC

Predicted protein sequences of Glyma02g47550

Limit To All Plant Sequences

>Glyma02g47550.1   sequence type=predicted peptide   gene model=Glyma02g47550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQVQVPPQNAFVTTSLYVGDLDPNIMDAQLYDLFNQLEQVISVRVCRDLTTRRSLGYGYVNFSNPQDAVVLLSCYIFI

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain