SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g47541): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g47541): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g47541

Feature Type:gene_model
Chromosome:Gm02
Start:51097629
stop:51100949
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G63380AT Annotation by Michelle Graham. TAIR10: ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein | chr3:23407112-23410213 REVERSE LENGTH=1033 SoyBaseE_val: 1.00E-15ISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006754GO-bp Annotation by Michelle Graham. GO Biological Process: ATP biosynthetic process SoyBaseN/AISS
GO:0006812GO-bp Annotation by Michelle Graham. GO Biological Process: cation transport SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0006882GO-bp Annotation by Michelle Graham. GO Biological Process: cellular zinc ion homeostasis SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009624GO-bp Annotation by Michelle Graham. GO Biological Process: response to nematode SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0070588GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transmembrane transport SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0005388GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium-transporting ATPase activity SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0015662GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
UniRef100_G7JKP8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Plasma membrane calcium-transporting ATPase n=1 Tax=Medicago truncatula RepID=G7JKP8_MEDTR SoyBaseE_val: 2.00E-55ISS
UniRef100_I1M6A4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M6A4_SOYBN SoyBaseE_val: 5.00E-88ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g47541 not represented in the dataset

Glyma02g47541 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma14g01140 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g305300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g47541.1   sequence type=CDS   gene model=Glyma02g47541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGGGAAGGTCTCAATTGGCTTGTTGATGAAAGCACTTGAGAGAGCTTTCTTGAGACCACAAGGAACGGTCTCCATTTTAACACGTCTTGTTACTGTTGCAATACTATGCGTGCAGCATGGAATGCCACTTGTGGTTACAGTTTCTCTCAAGTACCAGACTGATAAGGTAGTTCCAAACCAAGATGCAGTTCTTAATGATTTATCAGCTTGTACGACAATGGGGTTGGTAACTGTCATCTGTATTGATGTATCAGATGAGCTCATATGTAAGCCAATGGAGGTTAGTAGAGTATGGATGAGGGAGAAAGATATCAGCATGGTTGAGGGATCAAAAATAGATAAAACTGCGCTTGACATGCTTAAACAAGGAATTGGTTTATCAGTTCTTGCACCAGAGATTTCTCTTTCCTCTTTGTCTGTTTCACTTGTTTCTTGGGCAGAAACAACATGGGCAGTGAACATGAGATCTTTCACAGAAGAGAAATTTGACATTCTTAAGCACAGCAATCTGAATTCTGGCAAAGAAGGAAGGTGA

>Glyma02g47541.1   sequence type=predicted peptide   gene model=Glyma02g47541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKGKVSIGLLMKALERAFLRPQGTVSILTRLVTVAILCVQHGMPLVVTVSLKYQTDKVVPNQDAVLNDLSACTTMGLVTVICIDVSDELICKPMEVSRVWMREKDISMVEGSKIDKTALDMLKQGIGLSVLAPEISLSSLSVSLVSWAETTWAVNMRSFTEEKFDILKHSNLNSGKEGR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo