Glyma02g47410 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g47410): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g47410): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g47410

Feature Type:	gene_model
Chromosome:	Gm02
Start:	50998096
stop:	50999116
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g47410

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G25140	AT	Annotation by Michelle Graham. TAIR10: Nucleotide-diphospho-sugar transferases superfamily protein \| chr3:9154748-9156642 FORWARD LENGTH=559	SoyBase	E_val: 1.00E-35	ISS
GO:0010289	GO-bp	Annotation by Michelle Graham. GO Biological Process: homogalacturonan biosynthetic process	SoyBase	N/A	ISS
GO:0016051	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate biosynthetic process	SoyBase	N/A	ISS
GO:0045489	GO-bp	Annotation by Michelle Graham. GO Biological Process: pectin biosynthetic process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005768	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endosome	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005802	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
GO:0016758	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring hexosyl groups	SoyBase	N/A	ISS
GO:0047262	GO-mf	Annotation by Michelle Graham. GO Molecular Function: polygalacturonate 4-alpha-galacturonosyltransferase activity	SoyBase	N/A	ISS
PTHR13778	Panther	GLYCOSYL TRANSFERASE-RELATED	JGI		ISS
PTHR13778:SF3	Panther	GLYCOSYLTRANSFERASE 8 DOMAIN-CONTAINING PROTEIN 1	JGI		ISS
UniRef100_B9T3B4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Glycosyltransferase QUASIMODO1, putative n=1 Tax=Ricinus communis RepID=B9T3B4_RICCO	SoyBase	E_val: 7.00E-34	ISS
UniRef100_F6HCQ2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=F6HCQ2_VITVI	SoyBase	E_val: 3.00E-34	ISS

Expression Patterns of Glyma02g47410

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g47410 not represented in the dataset	Glyma02g47410 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g47410 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma02g47410

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g47410

Limit To All Plant Sequences

>Glyma02g47410.1   sequence type=CDS   gene model=Glyma02g47410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGTCTATAATTACTTCGTGCATGTTCGTAAATTCTGGGAAATTTTCAATGGAAATGTCAGTACTAGAAAGAGGAAAGTTTGTTATTTTTTAAATTGTGTTGTTGTTGATTCTAATGGTGGTGTTGAGTCAATAAGGAGATCCATTATTGCTCTGAAAACAGATCCCCTCAAGCCTCGTTTGGAGCAGATTCGCAAGCAAGCTGATGATCATGGCTCTTTGGCTCGTGTATGCTTCCTATGCACGCAAGCTCAAGCTGGAGAGCTCAAAGCTTGTAAGGATTTTCGCGGAGCTATGTGGCAACTTGGTGGATCTTATGAACAAACCTCAATACAGGCCTCTTTTCAGCAATCAGTGCTTCGCCAGGTGGTCGGGGACGCAAAGGAGTCCTTTGATAACCAGCTCAAGACTCAGAAGTTGAAAGATACAATTTTTGCAGTGAATGAACAGTTAACCAAGGCAAAGAAGCAGGGAGCTAATTCCAAAGAGCTTGCATTGTCTCTCCATGAGTACCATTATGCCTTATTCTCGGATAATGTTCTTGCGGCATCTGTTGTGGTCAATTCGGCAATGAAGAATGGGAACCGGACATTATGGAAATTAGGGACATTGCCGCCGGGTCTAATCACATATTACTCAACAACAAAGCCACTGAATAAGTCATGGCATGTTCTGGGACTTTGGCTACAACCCAAGCATCAGCATGGATGA

Predicted protein sequences of Glyma02g47410

Limit To All Plant Sequences

>Glyma02g47410.1   sequence type=predicted peptide   gene model=Glyma02g47410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVYNYFVHVRKFWEIFNGNVSTRKRKVCYFLNCVVVDSNGGVESIRRSIIALKTDPLKPRLEQIRKQADDHGSLARVCFLCTQAQAGELKACKDFRGAMWQLGGSYEQTSIQASFQQSVLRQVVGDAKESFDNQLKTQKLKDTIFAVNEQLTKAKKQGANSKELALSLHEYHYALFSDNVLAASVVVNSAMKNGNRTLWKLGTLPPGLITYYSTTKPLNKSWHVLGLWLQPKHQHG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain