SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g47070): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g47070): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g47070

Feature Type:gene_model
Chromosome:Gm02
Start:50791597
stop:50793069
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g47070
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G55850AT Annotation by Michelle Graham. TAIR10: RPM1-interacting protein 4 (RIN4) family protein | chr5:22603617-22604850 FORWARD LENGTH=95 SoyBaseE_val: 4.00E-27ISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF05627PFAM Cleavage site for pathogenic type III effector avirulence factor Avr JGI ISS
UniRef100_G7KEH8UniRef Annotation by Michelle Graham. Most informative UniRef hit: RPM1-interacting protein n=1 Tax=Medicago truncatula RepID=G7KEH8_MEDTR SoyBaseE_val: 1.00E-32ISS
UniRef100_I1JJK2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JJK2_SOYBN SoyBaseE_val: 8.00E-49ISS

Expression Patterns of Glyma02g47070
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g47070 not represented in the dataset
Glyma02g47070 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g47070
ParalogEvidenceComments
Glyma14g01681 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g47070 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g301100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g47070
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g47070
>Glyma02g47070.1   sequence type=CDS   gene model=Glyma02g47070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGGACACGGGTCGACCACTACCAAAGTTTGGTGAATGGGATGTCAATGATCCAGCTTCAGCTGAAGGCTACACGGTGATTTTCAACAAAGCTAGAAATGACAAAAAGACAGGTGGTGGCAAACCAGAGTCACCTGCAAAGGTTAATCCTCGTACCAGACGACCTCCGTTAGATCCAAGCAAAACACAAAGTAAAAAATGTTTTTGTTGCATACAAAGTCCTCCCGTGGAGTCATAG
Predicted protein sequences of Glyma02g47070
>Glyma02g47070.1   sequence type=predicted peptide   gene model=Glyma02g47070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSDTGRPLPKFGEWDVNDPASAEGYTVIFNKARNDKKTGGGKPESPAKVNPRTRRPPLDPSKTQSKKCFCCIQSPPVES*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo