|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G49310 | AT | Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 9 plant structures; EXPRESSED DURING: LP.04 four leaves visible, petal differentiation and expansion stage; Has 11 Blast hits to 11 proteins in 6 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 11; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:18237997-18238325 REVERSE LENGTH=82 | SoyBase | E_val: 7.00E-11 | ISS |
| GO:0000041 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transition metal ion transport | SoyBase | N/A | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PF10950 | PFAM | Protein of unknown function (DUF2775) | JGI | ISS | |
| UniRef100_I1JJK0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JJK0_SOYBN | SoyBase | E_val: 4.00E-73 | ISS |
| UniRef100_Q9FUP6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Suspensor-specific protein n=1 Tax=Phaseolus coccineus RepID=Q9FUP6_PHACN | SoyBase | E_val: 4.00E-27 | ISS |
|
Glyma02g47030 not represented in the dataset |
Glyma02g47030 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.02g300900 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma02g47030.1 sequence type=CDS gene model=Glyma02g47030 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAGCCCATCTTTGCCTTGTTCGTAGTCTTGTCGCTTCTCCTGGTTGCCAACATCAACTTAAGCCATGCAAGAAAAGACCTGGGGGATTATTGGAAGAAAATGATGAATGACGAACCCATGCCTGAAGCAATTAAAGATCTTATTCAAGATCAACAGGTACAAGATGCAACAGCAGATCATTTTATAAGGTACTTCGATATGAAGCCTAATATCATTTTGTATCACACCCATGTTGTGTCCAAGAAGCAGCAGCAGCAAAAGGCTTTTGACCACAAGTTTAAACCAGTCTCAAGGAACGGAAAGTCATGGTTGAACAAACCATAA
>Glyma02g47030.1 sequence type=predicted peptide gene model=Glyma02g47030 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKPIFALFVVLSLLLVANINLSHARKDLGDYWKKMMNDEPMPEAIKDLIQDQQVQDATADHFIRYFDMKPNIILYHTHVVSKKQQQQKAFDHKFKPVSRNGKSWLNKP*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||