SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g46740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g46740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g46740

Feature Type:gene_model
Chromosome:Gm02
Start:50605359
stop:50606682
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g46740
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G55570AT Annotation by Michelle Graham. TAIR10: unknown protein; LOCATED IN: chloroplast; Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr5:22514587-22515260 REVERSE LENGTH=143 SoyBaseE_val: 1.00E-31ISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
PF08792PFAM A2L zinc ribbon domain JGI ISS
UniRef100_I1JJH2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JJH2_SOYBN SoyBaseE_val: 8.00E-76ISS
UniRef100_Q00XT5UniRef Annotation by Michelle Graham. Most informative UniRef hit: WGS project CAID00000000 data, contig chromosome 12 n=1 Tax=Ostreococcus tauri RepID=Q00XT5_OSTTA SoyBaseE_val: 3.00E-15ISS

Expression Patterns of Glyma02g46740
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g46740 not represented in the dataset
Glyma02g46740 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g46740
ParalogEvidenceComments
Glyma14g01950 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g46740 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g297800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g46740
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g46740
>Glyma02g46740.2   sequence type=CDS   gene model=Glyma02g46740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AATGCAAGAAGAAGAAGGGTGGGTGCTGTGCCTGTGAATGTGGATGATGTAACCACAGTACTTGACCCAGCTCCAGTGCAAGTCACATGGCAAATTGTGGTTGGAGCTATAGAGAATGGTGTTCCGAAATTGGGTTTTGATTTTGTGTGTTTGAATTTTGCGGCTGGGGTTACCCCTTTTGTGGTGGCAGGGATTGAATTTAGCAAAAGAATTATAGCTCAAAAAAGATGTGAGGTGTGTGGAGGGTCAGGGCTTGTTCTTAGGGAAAAGGAAAAGGACTATCTCCGCTGCCCAGAATGTGGCGGGTTTCTTCCTTGGCAATCCTTGAAAAGATTCTTCTCCTGTTAA
Predicted protein sequences of Glyma02g46740
>Glyma02g46740.2   sequence type=predicted peptide   gene model=Glyma02g46740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
NARRRRVGAVPVNVDDVTTVLDPAPVQVTWQIVVGAIENGVPKLGFDFVCLNFAAGVTPFVVAGIEFSKRIIAQKRCEVCGGSGLVLREKEKDYLRCPECGGFLPWQSLKRFFSC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo