Glyma02g46340 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g46340

Feature Type:	gene_model
Chromosome:	Gm02
Start:	50328203
stop:	50329807
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g46340

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G20310	AT	Annotation by Michelle Graham. TAIR10: ethylene response factor 7 \| chr3:7085957-7086691 REVERSE LENGTH=244	SoyBase	E_val: 6.00E-49	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009873	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway	SoyBase	N/A	ISS
GO:0045892	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
PF00847	PFAM	AP2 domain	JGI		ISS
UniRef100_B9SYX3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor, putative n=1 Tax=Ricinus communis RepID=B9SYX3_RICCO	SoyBase	E_val: 1.00E-59	ISS
UniRef100_I1JJC8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JJC8_SOYBN	SoyBase	E_val: 1.00E-159	ISS

Expression Patterns of Glyma02g46340

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g46340

Paralog	Evidence	Comments
Glyma14g02360	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g46340 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g294100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g46340

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g46340

Limit To All Plant Sequences

>Glyma02g46340.1   sequence type=CDS   gene model=Glyma02g46340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGAAGGGCAGAGGTGGAGGCGCCTCGGCGGCGGCGGTGGATGTGAACGGATCCATTTTAAAGGAGCCTCGGTACCGGGGCGTGAGGAAGAGACCGTGGGGGAGATTCGCCGCGGAGATCAGAGACCCGTTGAAGAAAGCCAGGGTTTGGTTGGGAACCTTCGATTCTGCCGAGGATGCTGCTCGTGCCTACGACGCCGCCGCTCGGACTCTCCGAGGTCCCAAGGCCAAAACAAATTTCCCCCCTCTCTCACCTTTTTGCTATCCACACCCCACCACCGATCCTTTCTTCTACACTGGTTTCCACGATCAACACCACCACCACAACAACAACAACCTTAACAACCCTCAAAGACCCACTTCAAGTGGCATGAGTAGCACCGTTGAGTCCTTCAGTGGGCCCCGCCCTCCCACCACCACCACTACCACCACAATCACAACTGCGACGCCGTTTTTGACTGCTACGCGGAGATACCCGCGCACTCCCCCTCTTGTCCCTGAAGACTGCCACAGTGACTGCGACTCTTCCTCCTCCGTCGTTGACGACGGCGACGACAACATCGTTTCGTCGTCGTTTCGACCTCCCTTGCCGTTTGATCTCAACGCGCTGCCGTTTGATGATGCTGCCGCGGATGATGATCTACGCCGCACCGCGCTTTGTCTCTGA

Predicted protein sequences of Glyma02g46340

Limit To All Plant Sequences

>Glyma02g46340.1   sequence type=predicted peptide   gene model=Glyma02g46340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRKGRGGGASAAAVDVNGSILKEPRYRGVRKRPWGRFAAEIRDPLKKARVWLGTFDSAEDAARAYDAAARTLRGPKAKTNFPPLSPFCYPHPTTDPFFYTGFHDQHHHHNNNNLNNPQRPTSSGMSSTVESFSGPRPPTTTTTTTITTATPFLTATRRYPRTPPLVPEDCHSDCDSSSSVVDDGDDNIVSSSFRPPLPFDLNALPFDDAAADDDLRRTALCL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain