SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g46236

Feature Type:gene_model
Chromosome:Gm02
Start:50255952
stop:50258349
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g46236
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G72050AT Annotation by Michelle Graham. TAIR10: transcription factor IIIA | chr1:27115082-27117228 FORWARD LENGTH=412 SoyBaseE_val: 6.00E-112ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009410GO-bp Annotation by Michelle Graham. GO Biological Process: response to xenobiotic stimulus SoyBaseN/AISS
GO:0048522GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of cellular process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008097GO-mf Annotation by Michelle Graham. GO Molecular Function: 5S rRNA binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0080084GO-mf Annotation by Michelle Graham. GO Molecular Function: 5S rDNA binding SoyBaseN/AISS
PTHR11389Panther ZINC FINGER PROTEIN JGI ISS
UniRef100_G7IYR4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger protein n=1 Tax=Medicago truncatula RepID=G7IYR4_MEDTR SoyBaseE_val: 9.00E-151ISS
UniRef100_UPI0002336F17UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002336F17 related cluster n=1 Tax=unknown RepID=UPI0002336F17 SoyBaseE_val: 0ISS

Expression Patterns of Glyma02g46236
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g46236 not represented in the dataset
Glyma02g46236 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g46236 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g292900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g46236
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g46236
>Glyma02g46236.1   sequence type=CDS   gene model=Glyma02g46236   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAAAGTCATTCACTTGAGAGGCCATTTGTGTGTGCTGTCGATGATTGTCAGGCAAGTTACAGAAGAAAGGACCACCTGACTCAGCACCTTCTACAGCATGAAGGGAAGATTTTTAAGTGCCCTGTTGAGAATTGCAACAGTGAGTTCTCTTTGCAAAGCAATATGAAAAGACATACTGAGGAGATTCATGATGACAGTTCTACCACTACCAGTAGTGACAAAAGTCACAAACAGCATATGTGTCCAGAGATTGGCTGTGGAAAGGTTTTTAGATATGCATCACAGCTACAAAAACATGAAGATTCTCATGTTAATTTGGAATCAGTAGATATGGTGTGCTTAGAGCCTGGTTGCTTGAAACATTTCCCTAATGTCCAGTGCCTTCAAGCCCATGTGAAGTCCTCCCATCAGTATATGACCTGTGACATTTGCGGGACAAAGCAACTGAAGAAGAATATTAAACGTCATCTTCGATCACATGAAGCTGAAGGCAGTTCATCAGAGACCTTTCAATGCGAGTTTAAGGGTTGCAGCTGCACATTCTCAAGAAAATCTAATCTAGACAAGCATAAGAAGGCTGTGCACTTAAATGTAAAGCCTTTTGCTTGTGGGTTTCCTGATTGTGGCATGAGATTTGCTTACAAACATGTGCGAGATAATCATGAAAAAACTGCTAAACATGTTTTTACCCTTGGGGATTTTGAAGAAGCTGATGAAGAGTTCAGGTCAAGGCCAAGGGGAGGAAGGAAGAGAACATGTCCCACTGTTGAAGTGTTAATTAGGAAGAGGGTTACCCCACCTAGTCAATTGGAGCATTGGTTATTTATGCAGGATAGTGAGTAG
Predicted protein sequences of Glyma02g46236
>Glyma02g46236.1   sequence type=predicted peptide   gene model=Glyma02g46236   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQSHSLERPFVCAVDDCQASYRRKDHLTQHLLQHEGKIFKCPVENCNSEFSLQSNMKRHTEEIHDDSSTTTSSDKSHKQHMCPEIGCGKVFRYASQLQKHEDSHVNLESVDMVCLEPGCLKHFPNVQCLQAHVKSSHQYMTCDICGTKQLKKNIKRHLRSHEAEGSSSETFQCEFKGCSCTFSRKSNLDKHKKAVHLNVKPFACGFPDCGMRFAYKHVRDNHEKTAKHVFTLGDFEEADEEFRSRPRGGRKRTCPTVEVLIRKRVTPPSQLEHWLFMQDSE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo