SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g46210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g46210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g46210

Feature Type:gene_model
Chromosome:Gm02
Start:50240982
stop:50242139
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g46210
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G42570AT Annotation by Michelle Graham. TAIR10: B-cell receptor-associated 31-like | chr5:17021459-17022497 REVERSE LENGTH=218 SoyBaseE_val: 2.00E-44ISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR12701Panther BCR-ASSOCIATED PROTEIN, BAP JGI ISS
PTHR12701:SF1Panther B-CELL RECEPTOR-ASSOCIATED PROTEIN 31RELATED JGI ISS
PF05529PFAM B-cell receptor-associated protein 31-like JGI ISS
UniRef100_B9RXH8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Bcr-associated protein, bap, putative n=1 Tax=Ricinus communis RepID=B9RXH8_RICCO SoyBaseE_val: 5.00E-41ISS
UniRef100_I1JJB6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JJB6_SOYBN SoyBaseE_val: 4.00E-107ISS

Expression Patterns of Glyma02g46210
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g46210 not represented in the dataset
Glyma02g46210 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g46210
ParalogEvidenceComments
Glyma14g02520 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g46210 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g292600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g46210
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g46210
>Glyma02g46210.2   sequence type=CDS   gene model=Glyma02g46210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATACAACTTTTATTCATACTTTTGATGATCCAAATAGCATTCATCTTGATATTATCTTTTGCAAATCCAATACGAAAATTGGTGGTGATAGGGCTCGACCTTTTGAAGCAGGGGAGGGGCCCCTTAGTCACAAAAACTGTGGCAGCAACTATGTGTGTGGTCTTGAGCTCCACCGTGTATACTATAACCAAAATCCAAAAACGTTCAAAGGATGCTAGCATAGTTAATCCAACTGATGAGGTGTTGATGGCACATCGTCTCTTGGAAGCAGCTTTCTTGGGATTCTCTCTGTTCCTTGGATTGGTTATCGACAGACAACATTATTATATTAGAGAGATTAATTTACTAAGGAAGAACCTGGAAACATGGAAAAAACGAAATCACAATCATGACTCCTTAAAGAGAAGAGTGGAAACTGAGAAGCCAAATCCCAAAGGTCGAGCTCAAGTAAGCGGAAAGTGA
Predicted protein sequences of Glyma02g46210
>Glyma02g46210.2   sequence type=predicted peptide   gene model=Glyma02g46210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIQLLFILLMIQIAFILILSFANPIRKLVVIGLDLLKQGRGPLVTKTVAATMCVVLSSTVYTITKIQKRSKDASIVNPTDEVLMAHRLLEAAFLGFSLFLGLVIDRQHYYIREINLLRKNLETWKKRNHNHDSLKRRVETEKPNPKGRAQVSGK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo