Glyma02g46030 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g46030

Feature Type:	gene_model
Chromosome:	Gm02
Start:	50123442
stop:	50124142
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g46030

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G20340	AT	Annotation by Michelle Graham. TAIR10: Expression of the gene is downregulated in the presence of paraquat, an inducer of photoxidative stress. \| chr3:7093075-7093422 REVERSE LENGTH=115	SoyBase	E_val: 4.00E-11	ISS
GO:0006499	GO-bp	Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation	SoyBase	N/A	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1JJ96	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JJ96_SOYBN	SoyBase	E_val: 9.00E-61	ISS

Expression Patterns of Glyma02g46030

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g46030 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g290900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g46030

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g46030

Limit To All Plant Sequences

>Glyma02g46030.2   sequence type=CDS   gene model=Glyma02g46030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAATCCTACGTGGCACTACTTAGGTTTTTCATTTTCCTATTTATATCGGTAATATCATATCTCCCACCTAGTTTCCATCTTTTCTCTCTACGATTCATCGCAATTCACAAAATGGGCAATTGCTTGAGGCGCCAATCGCGGATCGGATACTCCACCGACGACGATGAGGACTGGGAGGATTTTCGGGCGGCGGCGGCGGCAAGCGGTGGTGTTAAGAAATCGACGAGAGAGGTGAAAATTAAGATAACGAAGAAGCAGTTGGTGGAGTTGGTTGGTAAAGTTGAGGTAAAGGAGTTGAGAATGGAACAGGTTTTGGCACACTTGATGAATCACTCTCTTCAACGTCCATGGAGGCCTGCTCTTCAAAGCATTCCAGAAGATCATTAA

Predicted protein sequences of Glyma02g46030

Limit To All Plant Sequences

>Glyma02g46030.2   sequence type=predicted peptide   gene model=Glyma02g46030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKSYVALLRFFIFLFISVISYLPPSFHLFSLRFIAIHKMGNCLRRQSRIGYSTDDDEDWEDFRAAAAASGGVKKSTREVKIKITKKQLVELVGKVEVKELRMEQVLAHLMNHSLQRPWRPALQSIPEDH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain