Glyma02g45570 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g45570

Feature Type:	gene_model
Chromosome:	Gm02
Start:	49784813
stop:	49785281
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g45570

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G06475	AT	Annotation by Michelle Graham. TAIR10: unknown protein; Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). \| chr1:1973992-1974273 REVERSE LENGTH=93	SoyBase	E_val: 2.00E-14	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1JJ40	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JJ40_SOYBN	SoyBase	E_val: 3.00E-41	ISS
UniRef100_Q9FQZ1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Avr9/Cf-9 rapidly elicited protein 180 n=1 Tax=Nicotiana tabacum RepID=Q9FQZ1_TOBAC	SoyBase	E_val: 5.00E-06	ISS

Expression Patterns of Glyma02g45570

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g45570

Paralog	Evidence	Comments
Glyma14g03330	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g45570 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma02g45570

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g45570

Limit To All Plant Sequences

>Glyma02g45570.1   sequence type=CDS   gene model=Glyma02g45570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGGAGGACAAGAACAAGAAGAAGAAGAAGAAGAGGAGCAAGTTGTGGTTGAAGAAGGTGTCGTGGCCGTTTCGGTGGAAACGACTGGATCTTCAAACGACCATCATGGACACCGTCGTTTTCAAGGTACTCTACGCGGCTGAGGCTGTAGTTCTTGTCTCCACCCTCTGCTTCTTCTACCTTTGTTGTGGCTGCCACTTCTGA

Predicted protein sequences of Glyma02g45570

Limit To All Plant Sequences

>Glyma02g45570.1   sequence type=predicted peptide   gene model=Glyma02g45570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMEDKNKKKKKKRSKLWLKKVSWPFRWKRLDLQTTIMDTVVFKVLYAAEAVVLVSTLCFFYLCCGCHF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain