Glyma02g45328 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g45328): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g45328): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g45328

Feature Type:	gene_model
Chromosome:	Gm02
Start:	49624877
stop:	49625663
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g45328

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G30860	AT	Annotation by Michelle Graham. TAIR10: glutathione S-transferase PHI 9 \| chr2:13139132-13140057 FORWARD LENGTH=215	SoyBase	E_val: 1.00E-62	ISS
GO:0006546	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycine catabolic process	SoyBase	N/A	ISS
GO:0006569	GO-bp	Annotation by Michelle Graham. GO Biological Process: tryptophan catabolic process	SoyBase	N/A	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0006970	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to osmotic stress	SoyBase	N/A	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0009627	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance	SoyBase	N/A	ISS
GO:0009684	GO-bp	Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process	SoyBase	N/A	ISS
GO:0010043	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to zinc ion	SoyBase	N/A	ISS
GO:0031347	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of defense response	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0004364	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glutathione transferase activity	SoyBase	N/A	ISS
GO:0004602	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glutathione peroxidase activity	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0043295	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glutathione binding	SoyBase	N/A	ISS
KOG0867	KOG	Glutathione S-transferase	JGI		ISS
PTHR11260	Panther	GLUTATHIONE S-TRANSFERASE, GST, SUPERFAMILY, GST DOMAIN CONTAINING	JGI		ISS
PTHR11260:SF55	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00043	PFAM	Glutathione S-transferase, C-terminal domain	JGI		ISS
UniRef100_G7K3B1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Glutathione S-transferase n=1 Tax=Medicago truncatula RepID=G7K3B1_MEDTR	SoyBase	E_val: 6.00E-73	ISS
UniRef100_I1JJ18	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JJ18_SOYBN	SoyBase	E_val: 8.00E-75	ISS

Expression Patterns of Glyma02g45328

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g45328 not represented in the dataset	Glyma02g45328 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g45328 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g283800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g45328

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g45328

Limit To All Plant Sequences

>Glyma02g45328.1   sequence type=CDS   gene model=Glyma02g45328   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAGTGAAGGTGTACGGTCCCAGCTGTGCTTCCACAAAACGGGTGCTAGTTTGTCTGGTTGAGAAGGAAATCGAATTTGAGGATATCCCTGTTGATATCTTCAAGGTGGAACAGAAAAATCCTGAGTTCCTCAAATTACAGTTTAATTTTGTTTCTTCTCTTACTGAATCTCGTGCTATAATGAGGTATTATGCAGAAAAATACAGATCTCAAGTGGTTGAGTTGCTGGGAAAGACAATAGAAGAGAGGGGTGTTGTGGAGCAATGGCTAGAAGTTGAGCACACAACTTTCACCCACCAGCCTACAACTCTTCATAGTGAAGCAAAGCTGGTGCGGGTGTTGAACATTTATGAGGAGAGGCTATCAAAGACTAAGTATTTGGCTGGAGATTTCTTCAGCCTTGCTGACATGAGCCACCTTCCTTTTCTTGAGTATAATGTGAACAAACTTGAGAAAGCGTATTTGATAAAGGAGAGGAAGCATGTGACTGCATGGTGA

Predicted protein sequences of Glyma02g45328

Limit To All Plant Sequences

>Glyma02g45328.1   sequence type=predicted peptide   gene model=Glyma02g45328   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVVKVYGPSCASTKRVLVCLVEKEIEFEDIPVDIFKVEQKNPEFLKLQFNFVSSLTESRAIMRYYAEKYRSQVVELLGKTIEERGVVEQWLEVEHTTFTHQPTTLHSEAKLVRVLNIYEERLSKTKYLAGDFFSLADMSHLPFLEYNVNKLEKAYLIKERKHVTAW*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain