SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g45200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g45200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g45200

Feature Type:gene_model
Chromosome:Gm02
Start:49544967
stop:49549646
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G08560AT Annotation by Michelle Graham. TAIR10: transducin family protein / WD-40 repeat family protein | chr5:2771104-2773827 REVERSE LENGTH=589 SoyBaseE_val: 0ISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0009630GO-bp Annotation by Michelle Graham. GO Biological Process: gravitropism SoyBaseN/AISS
GO:0009887GO-bp Annotation by Michelle Graham. GO Biological Process: organ morphogenesis SoyBaseN/AISS
GO:0009888GO-bp Annotation by Michelle Graham. GO Biological Process: tissue development SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010359GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of anion channel activity SoyBaseN/AISS
GO:0010413GO-bp Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process SoyBaseN/AISS
GO:0010638GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of organelle organization SoyBaseN/AISS
GO:0016926GO-bp Annotation by Michelle Graham. GO Biological Process: protein desumoylation SoyBaseN/AISS
GO:0031048GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA SoyBaseN/AISS
GO:0033044GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization SoyBaseN/AISS
GO:0042138GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation SoyBaseN/AISS
GO:0045132GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation SoyBaseN/AISS
GO:0045492GO-bp Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process SoyBaseN/AISS
GO:0050665GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide biosynthetic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
KOG0293 KOG WD40 repeat-containing protein JGI ISS
PTHR22838Panther WD REPEAT PROTEIN 26-RELATED JGI ISS
PF00400PFAM WD domain, G-beta repeat JGI ISS
UniRef100_G7KD13UniRef Annotation by Michelle Graham. Most informative UniRef hit: WD-repeat protein-like protein n=1 Tax=Medicago truncatula RepID=G7KD13_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1JJ06UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JJ06_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g45200 not represented in the dataset

Glyma02g45200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma14g03550 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g282600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g45200.1   sequence type=CDS   gene model=Glyma02g45200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAGGTGTGGAAGATGAAGAACCATCCATGAAGCGAATGAAATTATCCTCTAAAGGATTAGTTGGCTTGTCTAACGGTTCTTCTAAAGAACCTGTTAGAGGCTTGTCCAGTGACTTGATGGCTCAGCCCCTACTATCCAAAGAGGACGAACATGTTGTTGGTTCCAAAGGGGTTATAAAGAAAGAGGAATTTGTAAGGATAATTGCAAAGGCATTATACTCTCTTGGTTATGGAAAGAGTGGAGCACATCTAGAGGAGGAGTCTGGAATACCTTTACAATCACCTGGGGTAAATCTGTTTAGGCAACAAATACTTGATGGAAATTGGGATGACAGTGTAGCCACATTGTATAAAATTGGTCTGGCAGATGAAAGTATGGTCAGGTCAGCCTCATTCTTAATATTGGAGCAGAAATTCTTTGAACTTCTAAATGGTGAAAAGGTCATGGAAGCATTGAAGACCTTGAGGACAGAGATTGCTCCACTTTGCATTAATAATAGTAGAATTCGGGAACTTTCTTCCTGCTTAGTTTCACCATCTCCTAGGCTAGATATTCTAAGGGTGAGGTCTCGATCAAAGCTTCTGGAGGAATTGCAGAAACTTCTTCCCCCTACAGTAATGATACCTGAAAAGAGGTTGGAGCATCTAGTTGAACAAGCCCTTATCTTGCAACATGAGGCATGCCCATTTCATAATTCATTGGATAAGGAGATGTCATTATATTCAGATCATCATTGTGGAAAAGATCAGATACCTTCCAGTACATTACAGATATTAGAAGCACATGATGATGAAGTCTGGTTTGTACAATTCTCGCATAATGGGAAATATTTAGCTTCAGCATCAAATGATCGAACTGCAATAATTTGGGTGGTTGGCATAAATGGTAGACTGACTGTTAAGCATAGATTATCTGGTCACCAGAAGCCTGTTTCTTCCGTTTCATGGAGTCCTAATGACCAAGAGATCCTCACATGTGGAGTGGATGAGGCTATTAGGCGTTGGGATGTCTCTACTGGCAAATGCCTCCAAATTTATGAAAAAGCTGGGGCCGGTCTAGTCTCCTGTTCATGGTTTCCATGTGGGAAATATATACTCTGTGGCTTAAGTGACAAGAGCATTTGCATGTGGGAATTAGATGGGAAAGAAGTGGAGTCTTGGAAAGGACAAAAAACCCTTAAGATATCTGATTTGGAAATAACAGATGACGGGGAAGAGATTCTAAGTATTTGTAAAGCCAATGTGGTACTGTTGTTCAATAGAGAAACAAAGGATGAGAGATTTATTGAAGAGTATGAAACAATAACCTCCTTTTCTTTATCAAAGGATAACAAATTCTTGTTGGTTAATCTTTTGAACCAAGAAATTCATCTATGGAACATTGAAGGTGATCCTAAGCTTGTTGGCAAGTACAAAGGTCATAAACGCGCCCGTTTTATTATCAGGTCTTGCTTTGGTGGCCTTAAGCAAGCTTTTATTGCTAGTGGAAGTGAGGATTCACAGGTTTACATATGGCACAGAAGCTCAGGGGAGCTAATAGAAGCATTGACTGGTCATTCAGGATCTGTTAATTGTGTGAGCTGGAATCCAGCAAACCCCCACATGTTAGCCTCGGCCAGTGATGACCGGACAATTAGGGTATGGGGCCTAAATTGTATGCACAACAAGTACCAAAATGTTCACAGCAATGGCATCCATTACTGCAATGGAGGAACTTAG

>Glyma02g45200.1   sequence type=predicted peptide   gene model=Glyma02g45200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGGVEDEEPSMKRMKLSSKGLVGLSNGSSKEPVRGLSSDLMAQPLLSKEDEHVVGSKGVIKKEEFVRIIAKALYSLGYGKSGAHLEEESGIPLQSPGVNLFRQQILDGNWDDSVATLYKIGLADESMVRSASFLILEQKFFELLNGEKVMEALKTLRTEIAPLCINNSRIRELSSCLVSPSPRLDILRVRSRSKLLEELQKLLPPTVMIPEKRLEHLVEQALILQHEACPFHNSLDKEMSLYSDHHCGKDQIPSSTLQILEAHDDEVWFVQFSHNGKYLASASNDRTAIIWVVGINGRLTVKHRLSGHQKPVSSVSWSPNDQEILTCGVDEAIRRWDVSTGKCLQIYEKAGAGLVSCSWFPCGKYILCGLSDKSICMWELDGKEVESWKGQKTLKISDLEITDDGEEILSICKANVVLLFNRETKDERFIEEYETITSFSLSKDNKFLLVNLLNQEIHLWNIEGDPKLVGKYKGHKRARFIIRSCFGGLKQAFIASGSEDSQVYIWHRSSGELIEALTGHSGSVNCVSWNPANPHMLASASDDRTIRVWGLNCMHNKYQNVHSNGIHYCNGGT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo