SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g44560): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g44560): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g44560

Feature Type:gene_model
Chromosome:Gm02
Start:49105416
stop:49107582
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G54140AT Annotation by Michelle Graham. TAIR10: TATA binding protein associated factor 21kDa subunit | chr1:20214076-20214869 REVERSE LENGTH=183 SoyBaseE_val: 5.00E-73ISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0006352GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, initiation SoyBaseN/AISS
GO:0006366GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from RNA polymerase II promoter SoyBaseN/AISS
GO:0009560GO-bp Annotation by Michelle Graham. GO Biological Process: embryo sac egg cell differentiation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005669GO-cc Annotation by Michelle Graham. GO Cellular Compartment: transcription factor TFIID complex SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
KOG3334 KOG Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) JGI ISS
PTHR12075Panther TRANSCRIPTION INITIATION FACTOR TFIID COMPONENT JGI ISS
PF02291PFAM Transcription initiation factor IID, 31kD subunit JGI ISS
UniRef100_G7IVW0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription initiation factor TFIID subunit n=1 Tax=Medicago truncatula RepID=G7IVW0_MEDTR SoyBaseE_val: 1.00E-83ISS
UniRef100_I1JIU9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JIU9_SOYBN SoyBaseE_val: 4.00E-127ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g44560 not represented in the dataset

Glyma02g44560 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g277500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g44560.1   sequence type=CDS   gene model=Glyma02g44560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGATAAAGATGAAGAGCTGGCTATGCCAAGGGATGCAAAGATTGTGAAGTCTTTGATGAAATCAATGGGCGTGGAGGACTATGAACCTCGTGTTGTACACAAGTTTCTTGATTTATGGTATCGCTATATTGTTGACGTGTTAACGGATGCTCAAGTGTATTCAGAGCATGCAGACAAGTCTGAAATCGACTGTGATGATATTAAGCTTGCTATTCAATCCAAGCTTAACTTCAGTTTCTCGCAACCACCCCCTCGTGAGGTGCTTCTGGAGTTGGCTCATAACCGCAACAAGATACCATTGCCAAAGACTATAGCTGGACCTGTTATCCCGCTTCCACCTGATCAGGACACATTAATCAGTCCCAATTACATGTTTGCAATTCCAAACCAAAGGCCTGCTGAACCTCCTATAGAAGAAACAGAGGATGAAGAAGATACTAATACTATTCCCAACCCCTCCCAGGAAGAGCAGATAGTCATGCAACAGAATTCACCTCAAAGAGTATCATTTCCCCTGCCCAAACGCCAAAACGATTAA

>Glyma02g44560.1   sequence type=predicted peptide   gene model=Glyma02g44560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADKDEELAMPRDAKIVKSLMKSMGVEDYEPRVVHKFLDLWYRYIVDVLTDAQVYSEHADKSEIDCDDIKLAIQSKLNFSFSQPPPREVLLELAHNRNKIPLPKTIAGPVIPLPPDQDTLISPNYMFAIPNQRPAEPPIEETEDEEDTNTIPNPSQEEQIVMQQNSPQRVSFPLPKRQND*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo