SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g44371): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g44371): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g44371

Feature Type:gene_model
Chromosome:Gm02
Start:48956451
stop:48957438
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G20320AT Annotation by Michelle Graham. TAIR10: trigalactosyldiacylglycerol2 | chr3:7088589-7089640 REVERSE LENGTH=282 SoyBaseE_val: 7.00E-59ISS
GO:0006869GO-bp Annotation by Michelle Graham. GO Biological Process: lipid transport SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0032365GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular lipid transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009706GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast inner membrane SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005319GO-mf Annotation by Michelle Graham. GO Molecular Function: lipid transporter activity SoyBaseN/AISS
GO:0005543GO-mf Annotation by Michelle Graham. GO Molecular Function: phospholipid binding SoyBaseN/AISS
PF02470PFAM mce related protein JGI ISS
UniRef100_G7K7Q7UniRef Annotation by Michelle Graham. Most informative UniRef hit: ABC-type transport system involved in resistance to organic solvents periplasmic component n=1 Tax=Medicago truncatula RepID=G7K7Q7_MEDTR SoyBaseE_val: 2.00E-64ISS
UniRef100_UPI0002336CE3UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002336CE3 related cluster n=1 Tax=unknown RepID=UPI0002336CE3 SoyBaseE_val: 6.00E-97ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g44371 not represented in the dataset

Glyma02g44371 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma14g04440 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g275800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g44371.1   sequence type=CDS   gene model=Glyma02g44371   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAAAGGTCATCATCTACTACTTCAGAAGCAAAGAAACCACTTTCAGCTTTGTCAAACATTCTGCGCGCTGTTTGGAGGCAAAGAAACCAATTTTCTGCGTCCATTAAGTGATTTTGGGTTCAGTGATTGGAGCAACTGGGAAGGTGGGGTTGGACTGTTTCTAGTGTCTGTGGTGTTTGAGTATACTGAAGCTTGTGGCATAAGCAAAGGAACGCCTGTGAGAATCAGAGGGGCCACTGCTGGCAATGTCATTGGCGTGAATCCTTTCTTGAAAAGTATTGAAGCAGTTGTAGAGGTTGGTGATGATAAAACAGTTATATCACGAAATTCATTGATCAAGGTTAACCAGTCAGGTCTTCTTATGGAAACAAAAATTGACATCACTCCTCGTGAGCCAATTCCAACACCTTCTGTTGGCCCTCTTCACCAAGACTGTACTAAGGAAGGTCTTATTGTGTGTGATCGTGAAAAGATCAACAGTGACCAAGGAACAAGTTTGGATACATTGGTTGGAATATACTTCGGCCTTGACAGCGACAGAGAAAATTGGCATCATCAATAG

>Glyma02g44371.1   sequence type=predicted peptide   gene model=Glyma02g44371   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKGHHLLLQKQRNHFQLCQTFCALFGGKETNFLRPLSDFGFSDWSNWEGGVGLFLVSVVFEYTEACGISKGTPVRIRGATAGNVIGVNPFLKSIEAVVEVGDDKTVISRNSLIKVNQSGLLMETKIDITPREPIPTPSVGPLHQDCTKEGLIVCDREKINSDQGTSLDTLVGIYFGLDSDRENWHHQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo