SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g44285): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g44285): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g44285

Feature Type:gene_model
Chromosome:Gm02
Start:48888045
stop:48889687
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G27035AT Annotation by Michelle Graham. TAIR10: early nodulin-like protein 20 | chr2:11535670-11536251 FORWARD LENGTH=163 SoyBaseE_val: 2.00E-34ISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
PF02298PFAM Plastocyanin-like domain JGI ISS
UniRef100_G7K304UniRef Annotation by Michelle Graham. Most informative UniRef hit: Early nodulin-like protein n=1 Tax=Medicago truncatula RepID=G7K304_MEDTR SoyBaseE_val: 2.00E-47ISS
UniRef100_UPI0002336CE0UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002336CE0 related cluster n=1 Tax=unknown RepID=UPI0002336CE0 SoyBaseE_val: 8.00E-112ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g44285 not represented in the dataset

Glyma02g44285 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g275100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g44285.1   sequence type=CDS   gene model=Glyma02g44285   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTAAATCAGAGCTTCACTACGTTGGTGGGGACAAGTCTAGTTGGGGACCTAATGTTAACTTGACAGAATGGTCAAGTCATGAGCACTTCCATTTGGAAGATTGGCTTTACTTAATGATGTGCTTGCAAGACTTTGGATACGATAGAAACGAGTATAATGTACTAGAGGTGAACAAGACTGGTTATGAGAACTGCGTGGACACAGGATTTGTTCAAAACATATCAAGGGGTGCAGGAAGAGACGTGTTTCATCTAACAGAATTCAAGACCTACTACTTCTTAAGTGGAGGAGGCTATTGTTGGCATGGGATGAAGGTTGCTATATCTGTTACTGAAGGTGTTTCTGCACCCAATCCAGCCACTTCACCAAAAGGTGGTGCTCAAGCAAGTTCGCCAAAAAGTGGTTGTGCTTCAGACGGCATTCAAGTCAACCAAAAACTTTTGGAGTTCATCTTTGTCTTGATGTGGAGCATCTCTTCAATTAACATCAGTTACTAG

>Glyma02g44285.1   sequence type=predicted peptide   gene model=Glyma02g44285   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKSELHYVGGDKSSWGPNVNLTEWSSHEHFHLEDWLYLMMCLQDFGYDRNEYNVLEVNKTGYENCVDTGFVQNISRGAGRDVFHLTEFKTYYFLSGGGYCWHGMKVAISVTEGVSAPNPATSPKGGAQASSPKSGCASDGIQVNQKLLEFIFVLMWSISSINISY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo