SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g43750): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g43750): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g43750

Feature Type:gene_model
Chromosome:Gm02
Start:48473936
stop:48477619
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g43750
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G55140AT Annotation by Michelle Graham. TAIR10: ribosomal protein L30 family protein | chr5:22381370-22381787 FORWARD LENGTH=109 SoyBaseE_val: 6.00E-46ISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0015934GO-cc Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PF00327PFAM Ribosomal protein L30p/L7e JGI ISS
UniRef100_B9SH53UniRef Annotation by Michelle Graham. Most informative UniRef hit: Structural constituent of ribosome, putative n=1 Tax=Ricinus communis RepID=B9SH53_RICCO SoyBaseE_val: 3.00E-58ISS
UniRef100_I1JIK6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JIK6_SOYBN SoyBaseE_val: 2.00E-72ISS

Expression Patterns of Glyma02g43750
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g43750 not represented in the dataset
Glyma02g43750 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g43750
ParalogEvidenceComments
Glyma14g05160 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g43750 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g269800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g43750
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g43750
>Glyma02g43750.1   sequence type=CDS   gene model=Glyma02g43750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATGCGTTCAAGGCATACAAGGCCTGTGTGCCAATTGCTTGGAGCCCCAATATCTATATAACTCTGGTGAGGGGTATTCCAGGGACCAGGAGGCTCCATAGGCGCACTTTGGAAGCACTTCGCTTGCGCAAATGCAATCGAACTGTCATGCGATGGAACACACCTACAGTTAGGGGAATGCTCCAACAGGTCAAGAGGTTAGTTGTTATCGAGACAGAGGAAATGTACAAGGCACGCAAGCAGAAGGAGGAAGCACACAGAGCTCTTCGGTCTCCATTTGTCATAAGTCACAAACCTCCCTCGGTTACTGATGCTTTATAA
Predicted protein sequences of Glyma02g43750
>Glyma02g43750.1   sequence type=predicted peptide   gene model=Glyma02g43750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNAFKAYKACVPIAWSPNIYITLVRGIPGTRRLHRRTLEALRLRKCNRTVMRWNTPTVRGMLQQVKRLVVIETEEMYKARKQKEEAHRALRSPFVISHKPPSVTDAL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo