SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma02g43500

Feature Type:gene_model
Chromosome:Gm02
Start:48256852
stop:48257499
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G50640AT Annotation by Michelle Graham. TAIR10: ethylene responsive element binding factor 3 | chr1:18757602-18758279 REVERSE LENGTH=225 SoyBaseE_val: 2.00E-39ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0010105GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of ethylene mediated signaling pathway SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_H2BER5UniRef Annotation by Michelle Graham. Most informative UniRef hit: ERF transcription factor 5 n=1 Tax=Glycine max RepID=H2BER5_SOYBN SoyBaseE_val: 2.00E-80ISS
UniRef100_UPI000189CF49UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000189CF49 related cluster n=1 Tax=unknown RepID=UPI000189CF49 SoyBaseE_val: 1.00E-153ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma14g05470 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g267400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g43500.1   sequence type=CDS   gene model=Glyma02g43500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCGCCGAGGGAGAACCGCCGCCGCCGCTGCCGCCGTTGTGGATCCCACGCCGGACCAGGCCAAGGAGACGACGCGGTTCCGTGGCGTGAGGAAGCGGCCGTGGGGGCGATTCGCGGCGGAGATTCGAGATCCGTGGAAGAAGCAGCGCGTTTGGCTGGGGACCTTCGATTCCGCCGAGGATGCCGCGCGGGCCTACGACAAGGCTGCCCGATCCTTCCGCGGGCCCAAGGCCAAAACCAATTTCCCCCCCTTCCCCGGCCCGGCAGAGGCGGACCACCACTCGCAGATTCCGCTCTACCAGGCCCATGGGCTTTCCACCAAGTTCGAGCCCGTCGTCCAGGTGAACCGGCCCACGAGCAGCGGCATGAGCAGCACCGTGGAGTCCTTCAGCGGGCCTAGGGTTCCCTCCTCCTCCTCTCGCGCTAAGCCCCTTGTTGTGGTTGTTAACCCTATCATCCCTCTCAACGACGACGAAGACGATTGCCACAGCGATTGCGACTCTTCTTCCTCCGTCGTCGACGACGGCCAGGACTGCGTCCTCATCTCCTCCTTCCGGCAACCGCTGCCCTTCGATCTAAACCTCCCACCATCCGATGCCGACGACGACAACGACGACGACCTGCCGGCCACCGCGCTGTGCCTCTGA

>Glyma02g43500.1   sequence type=predicted peptide   gene model=Glyma02g43500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRRGRTAAAAAAVVDPTPDQAKETTRFRGVRKRPWGRFAAEIRDPWKKQRVWLGTFDSAEDAARAYDKAARSFRGPKAKTNFPPFPGPAEADHHSQIPLYQAHGLSTKFEPVVQVNRPTSSGMSSTVESFSGPRVPSSSSRAKPLVVVVNPIIPLNDDEDDCHSDCDSSSSVVDDGQDCVLISSFRQPLPFDLNLPPSDADDDNDDDLPATALCL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo