SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g42751

Feature Type:gene_model
Chromosome:Gm02
Start:47738562
stop:47741873
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g42751
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G05340AT Annotation by Michelle Graham. TAIR10: Peroxidase superfamily protein | chr5:1579142-1580819 REVERSE LENGTH=324 SoyBaseE_val: 2.00E-72ISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004601GO-mf Annotation by Michelle Graham. GO Molecular Function: peroxidase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
PF00141PFAM Peroxidase JGI ISS
UniRef100_G7J2Y6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peroxidase n=1 Tax=Medicago truncatula RepID=G7J2Y6_MEDTR SoyBaseE_val: 1.00E-92ISS
UniRef100_UPI0002336D1AUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002336D1A related cluster n=1 Tax=unknown RepID=UPI0002336D1A SoyBaseE_val: 3.00E-140ISS

Expression Patterns of Glyma02g42751
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g42751 not represented in the dataset
Glyma02g42751 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g42751 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g259500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g42751
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g42751
>Glyma02g42751.1   sequence type=CDS   gene model=Glyma02g42751   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTGGGTATGTCTTTTGTACGAAAGCTCCAATGGCTTCTTACTACTTCCTCCTCTTGCTAGTTCTCGTTGGTGCAACTACAGCAGCTTCTGAGGAAGAGCTATGCACAGACTTTTACTCCTGCACCTGCCCAAACTTGTTGCCTATAGTGAAGAAAGGAGTGGCCAAAGCCATTCAGAAAGAACCACGCATGGGGGCTTCCTTACTCCGATTGCATTTCCATCACTTCTTTGTAAACGGTTGTGATGCACCAATACTGTTGGATGATACAAGCAACTTCGTTGGAGAGCAAACAGCAGAAGCTAACAATCAATCAGCTAGAGGGTTCAACGTGATTAATGATATTAAGGCCAATGTGGAGAAAGAATGCCCCAGAGTGGTGTCATGTGCTGATATTCTTGCTCTGGCAGCTCGAGATTCTGTAGTTTGTTTAGGAGGACCTACTTGGGAAGTGGGGTTGGGGAGAAGAGCTTCTACTACAGCATGTAGAAGTGATGCTAATAACAACATTCCCGGGCCTTTCCTCAGTCTATCTGCTCTCATAAACAATTTTGCTAATCAAGACCTCTCAGTTACAGACTTGGTGGCTCTTTCAGGGGCACATACCATTGGCCTGGCTGAATGA
Predicted protein sequences of Glyma02g42751
>Glyma02g42751.1   sequence type=predicted peptide   gene model=Glyma02g42751   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIGYVFCTKAPMASYYFLLLLVLVGATTAASEEELCTDFYSCTCPNLLPIVKKGVAKAIQKEPRMGASLLRLHFHHFFVNGCDAPILLDDTSNFVGEQTAEANNQSARGFNVINDIKANVEKECPRVVSCADILALAARDSVVCLGGPTWEVGLGRRASTTACRSDANNNIPGPFLSLSALINNFANQDLSVTDLVALSGAHTIGLAE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo