SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g42543

Feature Type:gene_model
Chromosome:Gm02
Start:47588255
stop:47588799
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g42543
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G05560AT Annotation by Michelle Graham. TAIR10: E3 ubiquitin ligase, putative | chr5:1641452-1654685 FORWARD LENGTH=1678 SoyBaseE_val: 1.00E-19ISS
GO:0006302GO-bp Annotation by Michelle Graham. GO Biological Process: double-strand break repair SoyBaseN/AISS
GO:0006312GO-bp Annotation by Michelle Graham. GO Biological Process: mitotic recombination SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0007129GO-bp Annotation by Michelle Graham. GO Biological Process: synapsis SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0007276GO-bp Annotation by Michelle Graham. GO Biological Process: gamete generation SoyBaseN/AISS
GO:0032875GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA endoreduplication SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0042138GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0045132GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation SoyBaseN/AISS
GO:0051302GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell division SoyBaseN/AISS
GO:0051510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0000151GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ubiquitin ligase complex SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
PTHR12827Panther MEIOTIC CHECKPOINT REGULATOR TSG24 FAMILY MEMBER JGI ISS
PTHR12827:SF12Panther JGI ISS
UniRef100_G7K258UniRef Annotation by Michelle Graham. Most informative UniRef hit: Anaphase-promoting complex subunit n=1 Tax=Medicago truncatula RepID=G7K258_MEDTR SoyBaseE_val: 1.00E-47ISS
UniRef100_UPI0002337B3FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337B3F related cluster n=1 Tax=unknown RepID=UPI0002337B3F SoyBaseE_val: 3.00E-61ISS

Expression Patterns of Glyma02g42543
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g42543 not represented in the dataset
Glyma02g42543 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g42543 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma02g42543
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g42543
>Glyma02g42543.1   sequence type=CDS   gene model=Glyma02g42543   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCATCGGAGTCCGTCGCTTAACATTGCTGGGTGAGTTCAAGCCATTTGGCCTCATTGCCGAAGCCCTCGATGGCAAGCCCCCCGACACCGTCACCGACAAGTACGATTACTTCCTCTTCGATCCCGAAATCGCTCGAGACCGAGACGCCGACGACGATTGCGCCGACATCGCTTCTGCTCCGAGCAATCGTGGCGATCACGAGCTTTTCATCCGAGGCAATCGGATTATTTGGTCGACGGGTGCGAGAGTATTTAAGAGATTTACCCTGTCATCTGACATCGTTAAG
Predicted protein sequences of Glyma02g42543
>Glyma02g42543.1   sequence type=predicted peptide   gene model=Glyma02g42543   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSIGVRRLTLLGEFKPFGLIAEALDGKPPDTVTDKYDYFLFDPEIARDRDADDDCADIASAPSNRGDHELFIRGNRIIWSTGARVFKRFTLSSDIVK






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo