SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g42170): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g42170): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g42170

Feature Type:gene_model
Chromosome:Gm02
Start:47238864
stop:47243489
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g42170
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G39960AT Annotation by Michelle Graham. TAIR10: Microsomal signal peptidase 25 kDa subunit (SPC25) | chr2:16681666-16683491 REVERSE LENGTH=192 SoyBaseE_val: 2.00E-105ISS
GO:0006465GO-bp Annotation by Michelle Graham. GO Biological Process: signal peptide processing SoyBaseN/AISS
GO:0019932GO-bp Annotation by Michelle Graham. GO Biological Process: second-messenger-mediated signaling SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0008233GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidase activity SoyBaseN/AISS
KOG4072 KOG Signal peptidase complex, subunit SPC25 JGI ISS
PTHR13085Panther MICROSOMAL SIGNAL PEPTIDASE 25 KDA SUBUNIT JGI ISS
PF06703PFAM Microsomal signal peptidase 25 kDa subunit (SPC25) JGI ISS
UniRef100_I1JI59UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JI59_SOYBN SoyBaseE_val: 1.00E-130ISS
UniRef100_P58684UniRef Annotation by Michelle Graham. Most informative UniRef hit: Probable signal peptidase complex subunit 2 n=1 Tax=Arabidopsis thaliana RepID=SPCS2_ARATH SoyBaseE_val: 7.00E-103ISS

Expression Patterns of Glyma02g42170
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g42170 not represented in the dataset
Glyma02g42170 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g42170
ParalogEvidenceComments
Glyma14g06720 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g42170 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g254500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g42170
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g42170
>Glyma02g42170.1   sequence type=CDS   gene model=Glyma02g42170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTCCAAAGCTCCAAAGAAGGCCAATCTCCTCGATCACCACTCCATCAAGCACATCCTCGACGAGTCAGTCTCCGAGGTGGTAACGAGTCGTGGGTTTGTGGAAGACGTGAGATTGAGCAATGTGAGGCTTCTCATTGGGGCAATCATCATCGTCATTGCTCTCTTCGCCCAATTCTACAAGAAGAAGTTCCCTGAAAATAGGGATTTTCTCATCGCCTGCATCGCCTTGTATGTGATCTTCAATGGGTTGTTGCAGCTGATCATATACACTAAGGAGAAAAATGCCATTCTGTTCACTTATCCTCCTGTTGGATCCTTTACTAGTACCGGTTTGGTGGTTTCCTCCAAATTGCCTAGGTTTTCTGACATGTACACACTCACTATAGCAAGCGCAGATCCAAAATCAATTTCTGCAAATGATCAAGTACATTTCACCAAAAGTGTCACTCAGTGGTTCACTAAGGACGGAGTCTTAGTTGAGGGCCTGTTCTGGAAGGATGTTGAAGCTTTGATAGTTCAATATACTAAAGAACCAAAGAAGAGCAAGTAA
Predicted protein sequences of Glyma02g42170
>Glyma02g42170.1   sequence type=predicted peptide   gene model=Glyma02g42170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASKAPKKANLLDHHSIKHILDESVSEVVTSRGFVEDVRLSNVRLLIGAIIIVIALFAQFYKKKFPENRDFLIACIALYVIFNGLLQLIIYTKEKNAILFTYPPVGSFTSTGLVVSSKLPRFSDMYTLTIASADPKSISANDQVHFTKSVTQWFTKDGVLVEGLFWKDVEALIVQYTKEPKKSK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo