SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g41440

Feature Type:gene_model
Chromosome:Gm02
Start:46567328
stop:46569506
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g41440
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G38620AT Annotation by Michelle Graham. TAIR10: myb domain protein 4 | chr4:18053866-18054876 FORWARD LENGTH=282 SoyBaseE_val: 5.00E-77ISS
GO:0006598GO-bp Annotation by Michelle Graham. GO Biological Process: polyamine catabolic process SoyBaseN/AISS
GO:0006857GO-bp Annotation by Michelle Graham. GO Biological Process: oligopeptide transport SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009698GO-bp Annotation by Michelle Graham. GO Biological Process: phenylpropanoid metabolic process SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009805GO-bp Annotation by Michelle Graham. GO Biological Process: coumarin biosynthetic process SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0042398GO-bp Annotation by Michelle Graham. GO Biological Process: cellular modified amino acid biosynthetic process SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:2000762GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of phenylpropanoid metabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
KOG0048 KOG Transcription factor, Myb superfamily JGI ISS
PTHR10641Panther MYB-RELATED JGI ISS
PF00249PFAM Myb-like DNA-binding domain JGI ISS
UniRef100_C6SZ67UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZ67_SOYBN SoyBaseE_val: 1.00E-161ISS
UniRef100_G7KBP3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Myb-like transcription factor n=1 Tax=Medicago truncatula RepID=G7KBP3_MEDTR SoyBaseE_val: 8.00E-96ISS

Expression Patterns of Glyma02g41440
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g41440
ParalogEvidenceComments
Glyma14g07510 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g41440 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g247100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g41440
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g41440
>Glyma02g41440.1   sequence type=CDS   gene model=Glyma02g41440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGAAAACCTTGTTGTGACAAGGAAAACATCAATAAAGGTGCTTGGTCCAAGCAAGAAGACCAAAAGCTCATTGACTACATCCAAGTCCATGGTGAAGGCTGTTGGCGTTCCATTCCTAAAGCTGCTGGGCTGCATCGTTGTGGCAAAAGCTGTAGGATGAGATGGTTAAACTACTTACGACCAGGCATCAAACGTGGAATCTTTGCTGAAGATGAGGAAGACCTCATCATCAAACTCCATGCCCTCCTTGGTAACAGGTGGTCACTCATTGCTGGAAGGTTGCCTGGGAGGACAGACAATGAGGTGAAGAACTATTGGAATTCTCACATCCGAAGAAAACTAATAAAGATGGGAATTGATCCAAATAGCCATAAGCCACACCAAAGCTTTCCTCGTCCTCATGTTTCTTCTGCTGATCATCAGGGTGCATCAACATCTGAGTCCATCAACAACAACAAAGTCCCTTTCTTCAATTCCCGTGGTTCAGCTGCCACTGATCATCATAAGATTTCGTTCACTAAAGAAGAAACATCAATTATTTCATCACCCCCTTTGAATCTTGATCTTACAATTTCTTTACCTTCGCCTGTGGAAGAAAACAAAAATTCTGATCATGAGTCCGCCAAGACATGTGACGTGGATATAGATCTCAACTGTTAG
Predicted protein sequences of Glyma02g41440
>Glyma02g41440.1   sequence type=predicted peptide   gene model=Glyma02g41440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRKPCCDKENINKGAWSKQEDQKLIDYIQVHGEGCWRSIPKAAGLHRCGKSCRMRWLNYLRPGIKRGIFAEDEEDLIIKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHIRRKLIKMGIDPNSHKPHQSFPRPHVSSADHQGASTSESINNNKVPFFNSRGSAATDHHKISFTKEETSIISSPPLNLDLTISLPSPVEENKNSDHESAKTCDVDIDLNC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo